DATS - Field of type DATS

SAP data element DATS has the title "Field of type DATS".
It is part of development package SARC in software component BC-CCM-ADK. This development package consists of objects that can be grouped under "Archive Development Kit".

Properties of data element DATS

Property
DomainDATS
Data TypeDATS
Length8
Decimals0
Output Length10
Supports lower caseNo
Conversion Routine
Short DescriptionDate
Medium DescriptionDate
Long DescriptionDate in Format YYYYMMSS in 8 Characters

Tables with fields of type DATS

The data element DATS is used by fields in the following tables.

Table
Development Package
/ISDFPS/ALE_RBDSALE RDBSTATE: Time Stamp for Logging of Reports/ISDFPS/SYNCALE System Synchronization
THREIC_IBSUBSTEIC Inbox SubstitutionPAOC_EIC_APPL_INBOXEmployee Interaction Center: Agent Inbox
THREIC_IBSUBSTEIC Inbox SubstitutionPAOC_EIC_APPL_INBOXEmployee Interaction Center: Agent Inbox
HRSFEC_PN_FTSDPERNR-specific full transmission start datePAOC_PAD_SE_SFECService Enabling Employee Central Integration
HRSFEC_TIMSTAMPTable to save timestamp of Reports, ObjectsPAOC_PAD_SE_SFECService Enabling Employee Central Integration
SAFM_AP_TRACKMOFTracking information for MOF paymentsGLO_FM_SA_02Developments for Saudi Arabia Public Sector
SAFM_AP_TRACKMOFTracking information for MOF paymentsGLO_FM_SA_02Developments for Saudi Arabia Public Sector
FMEOP_CPD_CHECKEOP Check for PSMFMFSUpdating Funds Management
FMFG_REPOST_RCLRReversed clearing documents for ECC 600 migrationFMFG_EUS Federal Government budgetary ledger account derivation
BCA_FKK_DPD_HISTDays past due message history detailsFSCR_TRBKFI-CA Extended / Transactional Banking
/PM0/ABDQMIGSTATMigration Statistics Basic/PM0/AB_MIGRATIONFS-PM Basic System: Migration
/PM0/ALDQMIGSTATMigration Statistics Life/PM0/AL_MIGRATIONFS-PM Life: Migration
/MVA/AMDVMLTRLTable of Suffixes for Inquiries and Notif. for Penalty File/MVA/AMVM_DBAFS-PM Auto: Malus File Data Access Layer
/MVA/AMDBCMSYNCSynchronization of B/M with CM/MVA/AMT_CROSSFS-PM Auto: Integration Cross Objects
OIJ06_RIALERT_TTSW:Table to temporarily store alerts for Regional InventoryBACKND_TSWTSW Backend Package
OIGCMHTD Transport Unit Meter History fileOIGTD Transport and Distribution
OIGRMHTD Rack Meter History fileOIGTD Transport and Distribution
OIJ05_SHARETable for storing sharing detailsOIJ_TSW_05_APPLTSW HANA Developments Application Logic
OIJ05_SHARETable for storing sharing detailsOIJ_TSW_05_APPLTSW HANA Developments Application Logic
OIJ09_SCHEDSRCScheduling OptionsOIJ09_SCHDASST_BACKENDScheduling Assistant : Backend
OIJ09_SCHEDSRCScheduling OptionsOIJ09_SCHDASST_BACKENDScheduling Assistant : Backend
/ACCGO/T_QR_AP_QTable with details of Q-repository Grades Application Doc/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_QR_AP_WTable with details of Q-repository Weights Application Doc/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_STLHEADSettlement header table/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_UISANDTLDC Analysis Details/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_UISEVNTLDC Event Details/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_UISEVNTLDC Event Details/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_WASH_HNon standard Washout ID header table/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
GHO_ALERTStore Network AlertsAPPL_GHO_COMMON_ALERTPackage for Alert Framework
PIQDB_DE_STATHDRHeader Table for Statistical Reporting GermanyPMIQ_DE_STAT_REPORTINGStatistical Reporting
PIQDB_NL_DUOILOGDUO Incoming Message Error Log TablePMIQ_NL_BRONHOSLcM Netherlands - BRONHO
DFMCA_TAX_CASEData Table for Tax CasesFMCA_ISRPSCD: Internet Service Request
DFMCA_TC_PERSData Table for Periods of Tax CaseFMCA_ISRPSCD: Internet Service Request
DFMCA_TC_PERSData Table for Periods of Tax CaseFMCA_ISRPSCD: Internet Service Request
TEAMI_SMDSTRIGGSimplified Master Data Synchronization TriggerEE_AMI_BASICSAMI developments
TEAMI_EM_EVTATTRIS-U Event Management Attributes for AMI EventsEE_AMI_EM_COREISU Event Processing Core
EWA_EL_PJ_METAMeta data for GOS object at operations logEEWA_ENHANCED_LOGISTICSIS-U-WA: Enhanced Logistics
EWA_EL_PJ_METAMeta data for GOS object at operations logEEWA_ENHANCED_LOGISTICSIS-U-WA: Enhanced Logistics
EWA_EL_PJ_META_SSHA1-Hash for documentEEWA_ENHANCED_LOGISTICSIS-U-WA: Enhanced Logistics
EWA_EL_PJ_META_SSHA1-Hash for documentEEWA_ENHANCED_LOGISTICSIS-U-WA: Enhanced Logistics
CTE_D_REPL_QUEUEReplication Queue for Concur integration (failed, future)CTE_FND_IMPConcur T&E Integration: Central services like error handling
/PRA/BP_VEND_MDBusiness Partner (Vendor) Master Data/PRA/BUSINESS_PARTNERCustomer and vendor enhancements for PRA
/PRA/BP_VEND_MDBusiness Partner (Vendor) Master Data/PRA/BUSINESS_PARTNERCustomer and vendor enhancements for PRA
/PRA/BP_VEND_MDBusiness Partner (Vendor) Master Data/PRA/BUSINESS_PARTNERCustomer and vendor enhancements for PRA
/PRA/BP_VEND_MDBusiness Partner (Vendor) Master Data/PRA/BUSINESS_PARTNERCustomer and vendor enhancements for PRA
/PRA/BP_VEND_MDBusiness Partner (Vendor) Master Data/PRA/BUSINESS_PARTNERCustomer and vendor enhancements for PRA
/PRA/BP_VEND_MDBusiness Partner (Vendor) Master Data/PRA/BUSINESS_PARTNERCustomer and vendor enhancements for PRA
/PRA/TEMP_OWN_TPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/TEMP_OWN_TPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/TEMP_OWN_TPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/TEMP_OWN_TPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/TEMP_OWN_TPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/TEMP_OWN_TPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/TEMP_PP_OWNPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/TEMP_PP_OWNPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/TEMP_PP_OWNPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/TEMP_PP_OWNPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/TEMP_PP_OWNPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/TEMP_PP_OWNPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/T_PP_OWN_TPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/T_PP_OWN_TPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/T_PP_OWN_TPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/T_PP_OWN_TPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/T_PP_OWN_TPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/T_PP_OWN_TPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/WH_OWN_GRPTable for Saving Owner Group Details/PRA/WH_PROCESSINGWithholding Processing
/PRA/WH_OWN_GRPTable for Saving Owner Group Details/PRA/WH_PROCESSINGWithholding Processing
/PRA/WH_OWN_GRPTable for Saving Owner Group Details/PRA/WH_PROCESSINGWithholding Processing
/PRA/WH_OWN_GRPTable for Saving Owner Group Details/PRA/WH_PROCESSINGWithholding Processing
/PRA/WH_OWN_GRPTable for Saving Owner Group Details/PRA/WH_PROCESSINGWithholding Processing
/PRA/WH_OWN_GRPTable for Saving Owner Group Details/PRA/WH_PROCESSINGWithholding Processing
/SAPAPO/OMPROSESTable for holding information about profiling sessions/SAPAPO/OM_BASISInterface Between ABAP and liveCache Objects
CACNS_PM_PROJEasyProjectMarketCA_CNS_SERVICEPROVIDERCA_CNS_SERVICEPROVIDER
ETP_TASKSEasy Task Planning: TasksMPO_EASYTASKPLANNINGMPO_EASYTASKPLANNING
ETP_TASKSEasy Task Planning: TasksMPO_EASYTASKPLANNINGMPO_EASYTASKPLANNING
ETP_TASKSEasy Task Planning: TasksMPO_EASYTASKPLANNINGMPO_EASYTASKPLANNING
ETP_TASKSEasy Task Planning: TasksMPO_EASYTASKPLANNINGMPO_EASYTASKPLANNING
ETP_TASKSEasy Task Planning: TasksMPO_EASYTASKPLANNINGMPO_EASYTASKPLANNING
ETP_TEXTHEADEREasy Task Planning: Texts for TaskMPO_EASYTASKPLANNINGMPO_EASYTASKPLANNING
/CPD/DEMAND_HDRDemand Header Table/CPD/PFP_BOto be translated
/CPD/DEMAND_HDRDemand Header Table/CPD/PFP_BOto be translated
/CPD/D_EX_RATEPlan Exchange Rates/CPD/PFP_UTILProject Financial Planning Utilities
/CPD/D_PFP_PERPlan Exchange Rate/CPD/PFP_BOto be translated
/CPD/AVR_PRJ_CSTDummy table for actual cost of Commercial Projects/CPD/AVR_UTILUtility Package
/CPD/AVR_PRJ_CSTDummy table for actual cost of Commercial Projects/CPD/AVR_UTILUtility Package
/CPD/PWS_AGG_KDTKey Dates Aggregation Data/CPD/PWS_WS_UTILWorkspace Utilities
/CPD/PWS_AGG_KDTKey Dates Aggregation Data/CPD/PWS_WS_UTILWorkspace Utilities
/CPD/PWS_AGG_KDTKey Dates Aggregation Data/CPD/PWS_WS_UTILWorkspace Utilities
/CPD/PWS_AGG_KDTKey Dates Aggregation Data/CPD/PWS_WS_UTILWorkspace Utilities
START_DPPDPP Consent from userFRM_S4C_DBS4C Package for DDIC objects
START_DPPDPP Consent from userFRM_S4C_DBS4C Package for DDIC objects
FLOG_SUPLRITMAUXFL:Supplier Item Auxiliary TableFLOG_SERVICESField Logistics Services
EDOTRAPPRESeDocument: Application Response Queue#obsolete)GLO-EDO-TReDocument Turkey
DDLSVIEW_WLView Provisioning White Listed CDS View ObjectsODATA_VIEW_PROVISIONINGCDS views and OData Services for CDS View Provisioning
ALLOC_RUN_DOCAllocation run document relationODATA_RUN_ALLOCATIONRun Allocations
/SHCM/D_BP_SYNCBUPA Synchronization Log/SHCM/EMPLOYEE_BLEmployee: Business Logic
/SHCM/D_INCN_PNRInconsistent Pernr/SHCM/EE_ONE_MDS_S4_BLONEmds in S/4 OP - BL
/SLOAP/BILLINFOSLOAS Service Billing Information/SLOAP/SERVICESLOAS - Analysis Services Maintenance, Monitoring & Billing
CNVOM_DEL_TASKDeletion: task dependenciesCNV_OR_DELObject-based Transformation: Remote Deletion
CNVOM_DEL_TASKDeletion: task dependenciesCNV_OR_DELObject-based Transformation: Remote Deletion
/SLOAE/EX_ANALYSAnalysis table/SLOAE/FRAMEWORKSAP LT Analysis Service Framework
/SLOAE/EX_RUN_MModule runs/SLOAE/FRAMEWORKSAP LT Analysis Service Framework
/SLOAE/EX_RUN_MModule runs/SLOAE/FRAMEWORKSAP LT Analysis Service Framework
CNVA_CCD_ANA_STAState Table for CC Deletion Analysis PackageCNVA_CCD_ANACompany Code Deletion Downtime Analysis
CNVA_CCD_ANA_STAState Table for CC Deletion Analysis PackageCNVA_CCD_ANACompany Code Deletion Downtime Analysis
CNVA_00555_STATEState Table for Run Time EstimationCNVA_00555Chart of Accounts : Runtime Estimation
CNVA_00555_STATEState Table for Run Time EstimationCNVA_00555Chart of Accounts : Runtime Estimation
IUUC_REPL_DATAAGControl table for data agingCNV_IUUC_REPLICATIONIUUC: Replication tools
IUUC_FILE_ARCH_IIUUC file archive - item tableCNV_MDS_COREMDS Core reuse objects
DMC_CNTRLPARAMMWB: Control ParametersCNV_DMCMData Mapping and Conversion: Maintenance
DMC_COBJDMC: Conversion ObjectCNV_DMCMData Mapping and Conversion: Maintenance
DMC_FIXEDVALUEMWB: Fixed ValuesCNV_DMCMData Mapping and Conversion: Maintenance
DMC_RULEMapping Rules in DMC ToolCNV_DMCMData Mapping and Conversion: Maintenance
DMC_TROBJDMC: Recoding Object DefinitionCNV_DMCMData Mapping and Conversion: Maintenance
DMC_VARIABLEMWB: VariablesCNV_DMCMData Mapping and Conversion: Maintenance
IUUC_S4P_EHF_DOBSOLETECNV_DMC_DEACTIVATEDMWB: Deactivated Objects
IUUC_S4P_VBEPSOBSOLETECNV_DMC_DEACTIVATEDMWB: Deactivated Objects
IUUC_S4P_VBEPSOBSOLETECNV_DMC_DEACTIVATEDMWB: Deactivated Objects
CNVMBTATTACHMENTAttachmentsCNV_MBT_PCL_46MBT PCT : Process controlling functions 4.6
CNVMBTCUSTTREECustomizing data for a displayed treeCNV_MBT_PCL_46MBT PCT : Process controlling functions 4.6
CNVMBTCUSTTREECustomizing data for a displayed treeCNV_MBT_PCL_46MBT PCT : Process controlling functions 4.6
CNVMBTNOTESNotesCNV_MBT_PCL_46MBT PCT : Process controlling functions 4.6
RSH_D_USG_WCWork Center Usage/AuditRSH_DB_USAGEWork Center Usage / Audit
RSH_D_PROJASGPDDI_RSHPROJECTASSIGNMENTTP I_RSHPROJECTASSIGNMENTPERDAYTPRSH_CDS_PROJECT_ASGResource Scheduling CDS Views for Project Assignment
RSH_D_PROJASGPDProject Assignment Per DayRSH_DB_PROJECT_ASGResource Scheduling Database Tables for Project Assignment
CATS_V1_WORKLISTUser Defined Work ListODATA_HCM_CATS_MAN_V1OData Services for Timesheet Entry (TETRIS UI)
CATS_V1_WORKLISTUser Defined Work ListODATA_HCM_CATS_MAN_V1OData Services for Timesheet Entry (TETRIS UI)
CATS_V1_WORKLISTUser Defined Work ListODATA_HCM_CATS_MAN_V1OData Services for Timesheet Entry (TETRIS UI)
HCM_CATS_NOTIFYTest HCM notificationsODATA_HCM_CATS_NOTIFYOData Services for Timesheet Notifications
LCM_DOCSTS_CHG_DI_LCMDOCUMENTTP I_LGLCNTNTMDOCSTATUSCHGSTPAPPL_LCM_DOCApplication Package for Documents
LCM_DOC_STS_CHGSDocument Status ChangesAPPL_LCM_DOCApplication Package for Documents
CKQS_MAP_IDMapping of Costing Run ID + Data Basis to VariantPI_CK_QSSetup and Transfer of R/3 Quantity Structures
CCGLT_PRTREQ_DETPrint Request Spool MessagesCBGLMP_APIEHS: API Implementations
CCGLT_PRTREQ_DETPrint Request Spool MessagesCBGLMP_APIEHS: API Implementations
FUDT_DOCVERACTLAction logs of FI document verificationEA_FIN_UI_DECO_API_VERIFYFrontend Backend Decoupling - APIs for Verification
DFKKDUNBWERRFI-CA Dunning: Error during ExportFKKBWFI-CA: BW Extraction
BPCT_CRM_GUIDSAssignment: Contact Key -> Activity GUIDBPCTBusiness Partner Contact
DFKKINV_OFFSETIDAllocation Table Longer Than a Short Offsetting ID KeyFKKINVInvoicing
CFIN_AIF_CE_SERCentral Finance: AIF Message Serialization for Cost EstimateFINS_CFIN_AIF_INTEGRATIONCentral Finance - AIF Integration
FAR_D_APPSTATETemporary storage of application statesAPPL_FIN_ODATA_ARoData Services - Accounts Receivable Accounting
FMEUROPLANTable of Euro FM AreasFMBU_COREFunds Management - Budgeting (Core Objects)
FMEUROPLANTable of Euro FM AreasFMBU_COREFunds Management - Budgeting (Core Objects)
FAGL_GCDVC_XBRLGCD-Structure: Value of ItemsFAGL_XBRL_GCDElectronic Financial Statement Master Data (GCD)
FDC_D_DFT_HDRHeader Table for draftsFINS_FI_DECOUI Decoupling FI Posting
/LSIERP/PROC_LOGPersistence for Payment Trigger Containing Errors/LSIERP/LAM_PROCEEDSComponents for Calculating Payments
/LSIERP/PROC_LOGPersistence for Payment Trigger Containing Errors/LSIERP/LAM_PROCEEDSComponents for Calculating Payments
IDIN_FIAA_ADJUSTAdjustment values for the block and opening WDV - IndiaID-FIAA-INFIAA Localization # India
SIPT_PRINT_CHKTable for logging printing in FI/SD/FI-CAID-SIGN-PTLocalization - Digital Signature Portugal
CMCBD_CONSUMECash Budgeting ConsumptionEA_FIN_CM_CB_PLANNING_SRVService for Cash Budgeting
RDSV_OUT_COPYTable for logging printing in FI/SD/FI-CAID-RDSV-XXRegulatory Document and Signature Validation
EAFI_CM_AUDITCash Audit TableEA_FIN_CM_COMMONCommon feature of Cash Management
CASH_AUDITCash Audit TableID-FI-EPIC-GEN-UIGlobalization: E-Payment Integration User Interface Objects
FICLD_CNTRLRTUpdate Remittance TypeID-FI-CIFI Localization (Chile)
FICLD_CNTRLRTUpdate Remittance TypeID-FI-CIFI Localization (Chile)
FIHUC_VATLIMITObsolete - Define VAT limit for HungaryID-FI-HULocalization Hungary
FIHUC_VATLIMITObsolete - Define VAT limit for HungaryID-FI-HULocalization Hungary
/ATL/KP012CTable of addition info to house bank./ATL/CASHIRcashier system
/ATL/KPATARCashier table - plant definition./ATL/CASHIRcashier system
/ATL/KPKUPACashier table - Cashier definition/ATL/CASHIRcashier system
/ATL/KPKUPBCashier table - Payment method/ATL/CASHIRcashier system
/ATL/KPKUPCCashier Table - allowed payment method for tranfers/ATL/CASHIRcashier system
/ATL/KPKUPDCashier Table - Subject definition/ATL/CASHIRcashier system
FIAPPTD_RUNIDTable to store the Run ID details of the CBR PT ReportingID-FI-PTAdd-On Development - FI - Portugal
J_3RBUE_BK_HTABLTable head for EXTRACTJ3RFLocalization Russia: FI
J_3RBUE_BK_HTABLTable head for EXTRACTJ3RFLocalization Russia: FI
J_3RBUE_BK_HTABLTable head for EXTRACTJ3RFLocalization Russia: FI
J_3RBUE_BK_HTABLTable head for EXTRACTJ3RFLocalization Russia: FI
J_3RBUE_BOOK_INDTable for PurBook (ALV) NAMES for Num lines IND-<NUMJ3RFLocalization Russia: FI
J_3RBUE_BOOK_INDTable for PurBook (ALV) NAMES for Num lines IND-<NUMJ3RFLocalization Russia: FI
J_3RBUE_BOOK_INDTable for PurBook (ALV) NAMES for Num lines IND-<NUMJ3RFLocalization Russia: FI
J_3RBUE_BOOK_INDTable for PurBook (ALV) NAMES for Num lines IND-<NUMJ3RFLocalization Russia: FI
J_3RBUE_BOOK_NUMTable for PurBook (ALV) numbers of linesJ3RFLocalization Russia: FI
J_3RSL_BK_HTABLTable head for EXTRACTJ3RFLocalization Russia: FI
J_3RSL_BK_HTABLTable head for EXTRACTJ3RFLocalization Russia: FI
J_3RSL_BK_HTABLTable head for EXTRACTJ3RFLocalization Russia: FI
J_3RSL_BK_HTABLTable head for EXTRACTJ3RFLocalization Russia: FI
J_3R_FATAXTransport Tax DataJ3RALFLocalization Russia - Legal Forms
J_3R_FATAXTransport Tax DataJ3RALFLocalization Russia - Legal Forms
J_3R_FATAXTransport Tax DataJ3RALFLocalization Russia - Legal Forms
J_3R_FATAXTransport Tax DataJ3RALFLocalization Russia - Legal Forms
J_3R_FATAXTransport Tax DataJ3RALFLocalization Russia - Legal Forms
J_3R_PTAX_ABROADTax Paid Abroad Property taxJ3RALFLocalization Russia - Legal Forms
/ILE/TV01FAnnex reference/ILE/ANNEXAnnexing - General data
/ILE/TV01SAnnex reference - Simulation/ILE/ANNEXAnnexing - General data
/ILE/TV04MMAnnex reference MM/ILE/ANNXMMIL Localizatioon - Annexing in MM
/ILE/TV04MM_SIMAnnex reference MM For simulations only/ILE/ANNXMMIL Localizatioon - Annexing in MM
FIEUD_USER_HISTSAFT: User history for extraction detailsID-FI-SAFTSAF-T Reporting (generic parts)
FIPLD_USER_HISTSAFT: User history for extraction detailsID-FI-PL-SAFTSAFT Poland
BNK_BTCH_TIMEOUTBatch timeoutFIN_BNK_COM_COREBank Communication: Core Objects
BNK_BTCH_TIMEOUTBatch timeoutFIN_BNK_COM_COREBank Communication: Core Objects
FCLM_BAM_REQLOGChange request log for bank account master dataFCLM_BAMBank Account Management
FCLM_BRM_PRC_STS[Obsolete] Service Pricing StatusFCLM_BRMBank Relationship Management
UKM_TRANSFER_ARVData from AR for SAP Credit ManagementUKM_GENERALConnection to SAP Credit Management
UKM_DNB_MONITORDNB Monitor Registration StatusUKM_DNB_PROCSAP Credit Management - Processes
UKM_DNB_MONITORDNB Monitor Registration StatusUKM_DNB_PROCSAP Credit Management - Processes
UKM_DNB_REPORTStores DNB Report DataUKM_DNB_PROCSAP Credit Management - Processes
UKM_DNB_TRADEUPFSCM-CR: Table for Logging of DnB Trade Up ImportsUKM_DNB_PROCSAP Credit Management - Processes
/PF1/DB_ACCR_PIaccrual item DB/PF1/ACCRUAL_PROCESSprocess layer for the accrual component hallo
/PF1/DB_ACCR_POaccrual order DB/PF1/ACCRUAL_PROCESSprocess layer for the accrual component hallo
TREAT_ASSIGNMENTTreasury: TREA AssignmentFTR_EXTERNAL_ACCOUNT_MGTTreasury External Account
TREAT_ASSIGNMENTTreasury: TREA AssignmentFTR_EXTERNAL_ACCOUNT_MGTTreasury External Account
TREAT_MLM_CALRUNTreasury MLM Calculation RunFTR_EXTERNAL_ACCOUNT_MGTTreasury External Account
TOET_SNAPSHOTSnapshotFTOE_SNAPSHOT_COREOrganized Exposure: Snapshot
REGT_DATA_POINTSData Points of Regression CalculationFTRM_REGRESSION_SERVICEWrapper for the tool
TWSPVSecurity Prices for Special ValuationFVVWTreasury Management: Securities
VTB_ASGN_RELATFTR Assignment Management: Assignment ObjectFTTRTreasury: Financial Transaction
VTB_ASGN_RELATFTR Assignment Management: Assignment ObjectFTTRTreasury: Financial Transaction
VDCORR_ALOILoans: Search Index for Correspondence (Document Finder)FVVD_CORR_PRINTLoans: Central Modules for Correspondence Tool
VDCAPITALData for Capitalization of Overdue ItemsFVVCL_DEFCAPPayment Agreements (Deferral / Capitalization)
ISAERSLISTERS Collective Settlement ListISAUTO_MRMEnhancements to Log. IV; ERS With Handling Surcharge, Reval.
ISAERSLISTERS Collective Settlement ListISAUTO_MRMEnhancements to Log. IV; ERS With Handling Surcharge, Reval.
DIWP_DISPOBSOLETE: Display Work Packages Per UserDIWPSDI: Work Packaging and Sequencing
BKK9IWVariant Condition FixingsFKBCBank Customer Accounts: Conditions
/DSD/ME_CREDITDSD Connector: Credit data/DSD/ME
/DSD/ME_DEL_HDDSD CN: Delivery Header Data/DSD/ME
/DSD/ME_DEL_HDDSD CN: Delivery Header Data/DSD/ME
/DSD/ME_OPIM_HDDSD CN: Open Items header data/DSD/ME
CMM_ORTH_MATUREOrthodox Maturity Selection for PricingLOG_CMM_BASISBasis Handling
CMM_ORTH_MATUREOrthodox Maturity Selection for PricingLOG_CMM_BASISBasis Handling
GTCN_TR_F_ITEMTax Refund File ItemGLO_GLT_TR_TAXREF_CNTax Refund: Global Trade Localization for China
IARUNSPSTATVAL_DI_ARUNSUPPLYSORTRULETP I_ARUNSUPSTATICSORTATTRIBVALTPARUN_COREPackage for Objects of core a-run process
FRE_ORD_FILE_OUTFilenames of saved files from OutboundWFRE_PIConnectivity with F&R
WGRC_ACTCurrent Capacity Data for Doors or Staging AreasWGRCGoods Receipt Capacity Check in Purchasing
WGRC_ACTCurrent Capacity Data for Doors or Staging AreasWGRCGoods Receipt Capacity Check in Purchasing
FIP_D_CONTRContract DataFIP_DDICDDIC package for Fresh Item Procurement
FIP_D_S_PRICESBuffer table for sales prices informationFIP_DDICDDIC package for Fresh Item Procurement
FIP_D_UPD_DAT_SPDate for last update of transactional buffer data for a SPLTFIP_DDICDDIC package for Fresh Item Procurement
WDFR_DISPPerishables Planning HeaderWO+GRetail Development for Perishables
VCH_SIMULATIONVariant Configuration: SimulationsODATA_LO_VCHCLF_SIMULATIONOData Service - Simulation Environment
VCH_SIMULATION_DDeprecated - P_I_VCH_SIMULATION_TP P_I_VCH_SIMULATION_TPODATA_LO_VCHCLF_SIMULATIONOData Service - Simulation Environment
VCH_SIM_CONTEXTSimulation Environment ContextODATA_LO_VCHCLF_SIMULATIONOData Service - Simulation Environment
VCH_SIM_DRAFTI_VARIANTCONFIGURATIONSIMLNTP I_VARIANTCONFIGURATIONSIMLNTPODATA_LO_VCHCLF_SIMULATIONOData Service - Simulation Environment
WTY_PRCD_ITEMS_DDraft table for entity R_WRNTYCLAIMITEMPRICINGTPRAP_LO_WTYRAP WTYBehavioral and Model Implementation Artifacts package
WTY_PRCD_VERS_DDraft table for entity R_WRNTYCLAIMACTVVERSITEMPRCGTPRAP_LO_WTYRAP WTYBehavioral and Model Implementation Artifacts package
DIACL_CLISTDI CLIST: Component dataDI_CCM_CMPLIST
TTS_HOT_SUBTable Control Data for Hot Sub ScreenGLO_LOG_PM_LCAM_CNLCAM Developments for China
PPSCH_CHG_OPERChanged Operations for Schedule ProductionPPH_CAP_SCHEDPRODNSchedule Productions
PPSCH_CHG_OPERChanged Operations for Schedule ProductionPPH_CAP_SCHEDPRODNSchedule Productions
STCK_WORKLISTAccepted solutions for Issue Stock ChampionODATA_PP_SCStock Champion
STCK_WORKLISTAccepted solutions for Issue Stock ChampionODATA_PP_SCStock Champion
STCK_WORKLISTAccepted solutions for Issue Stock ChampionODATA_PP_SCStock Champion
PPH_CACHE_ITEMSupply demand items and uncovered demand itemsPPH_DDICPP on HANA: Dictionary objects
PPH_CACHE_ITEMSupply demand items and uncovered demand itemsPPH_DDICPP on HANA: Dictionary objects
PPH_CACHE_ITEMSupply demand items and uncovered demand itemsPPH_DDICPP on HANA: Dictionary objects
PPH_CACHE_MATCache Table MaterialPPH_DDICPP on HANA: Dictionary objects
PPH_CACHE_MATCache Table MaterialPPH_DDICPP on HANA: Dictionary objects
PPH_CACHE_MATCache Table MaterialPPH_DDICPP on HANA: Dictionary objects
PPH_CACHE_MATCache Table MaterialPPH_DDICPP on HANA: Dictionary objects
PPH_CACHE_PLSEGCache Table Planning SegmentPPH_DDICPP on HANA: Dictionary objects
PPH_CACHE_PLT_DTCurrent dates of PlantPPH_DDICPP on HANA: Dictionary objects
PPH_CACHE_PLT_DTCurrent dates of PlantPPH_DDICPP on HANA: Dictionary objects
PPH_CACHE_PLT_THTime horizons of MRP bufferPPH_DDICPP on HANA: Dictionary objects
PPH_CACHE_SUPPLCache Table SupplierPPH_DDICPP on HANA: Dictionary objects
PPH_MRP_PERIODSPeriod table for lot-sizing in MRPPPH_MRPPP on HANA: MRP package
PPH_MRP_PERIODSPeriod table for lot-sizing in MRPPPH_MRPPP on HANA: MRP package
PPH_MRP_PERIODSPeriod table for lot-sizing in MRPPPH_MRPPP on HANA: MRP package
T705ZCommunication Times (Obsolete #73)CIBDWork Order Time Recording
INM_M_OBJ_MET_VAMetrics ValuesINM_METRICSMetrics Management
INM_S_PARAMShares parameter for navigationINM_SHAREDPPM Cross Application UI Objects
KPERPeriod Values for Workforce PlanningCYMPWorkforce Planning
VSKPER_CNVersion: Workforce PlanningCNVSR/3 Application development: Version Management
TCNTM06Dates for Components, Events and Date TypeCN_NET_OPROperative Network
VIAK08DME Settlement Units Master DataFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIIPMEAS_DDraft table for entity R_REINTEGOBJECTMEASUREMENTTPVDM_RE_IPRE: Virtual Data Model for Integration Platform (VDM)
VIIPMEAS_DDraft table for entity R_REINTEGOBJECTMEASUREMENTTPVDM_RE_IPRE: Virtual Data Model for Integration Platform (VDM)
VICNCN_DDraft table for entity R_RECONTRACTTPVDM_RE_CNRE: Virtual Data Model for Contract (VDM)
VEIAVINTRASTAT Receipt/DispatchVEIApplication development R/3 foreign trade
SDXPRA_VBPATWINVBPA key and PERNR for Twins (for CL_SD_XPRA_VBPA_PERNR)VA_XPRAXPRA related objects for oP upgrade to S/4HANA - Sales
SDXTST_VBPATWINVBPA key and PERNR for Twins (only for XPRA test)VA_XPRAXPRA related objects for oP upgrade to S/4HANA - Sales
/CFG/AUTMATION_HHeader table for WEBGUI Automation/CFG/FTI_WEBGUIWebGUI based Fine Tunning Infrastructure
/FTI/CHG_LOG_HDRChange Log header/FTI/WEBGUI_SSCUISSC UI Development - Web gui area
/FTI/EXP_CONFXMLExpert Configuration XML/FTI/WEBGUI_SSCUISSC UI Development - Web gui area
/FTI/EXP_XMLExpert Configuration XML/FTI/WEBGUI_SSCUISSC UI Development - Web gui area
E2EIE_TC_TEMPLTest Plan Template of Test CockpitODATA_ICODATA Implementation Cockpit
/SMB/BB_STATUSBuilding Blocks Implementation Status/SMB/DDICCommonly used DDIC-Objects
/SMB/RC_CHANGERecording change table/SMB/DDICCommonly used DDIC-Objects
/SMB/RC_GROUPRecording change - group/SMB/DDICCommonly used DDIC-Objects
/SMB/USR_SOL_FILSolution Filter Preferences by User/SMB/DDICCommonly used DDIC-Objects
/SMB/USR_SOL_FILSolution Filter Preferences by User/SMB/DDICCommonly used DDIC-Objects
/CFG/REL_TRProject Transport Information/CFG/CORE_COMMONCommon Objects
/EACA/TPMCUCHARConditional Characteristic Use Profitability Analysis/EACA/PROFITABILITY_MANAGEMENTE-Accounting: Profitability Management
UBC_TB_GUIDGUID for USER, ORG. WI_IDUBC_CSPFSCM Biller Consolidator-Prototype for CSP with Acct.Assgnmt
UBC_TB_NOTESTable for NotesUBC_CSPFSCM Biller Consolidator-Prototype for CSP with Acct.Assgnmt
PAMODCTDPTDPP: Cap. Requirement of an Activity-Resource RelationshipCPPETDPPackage for iPPETime Dependent Process Parameter
PAMODDTDPTDPP: Duration of an Activity-Resource RelationshipCPPETDPPackage for iPPETime Dependent Process Parameter
PNACTTDPTDPP: Scrap for the ActivityCPPETDPPackage for iPPETime Dependent Process Parameter
PVCMPDTDPiPPE TDPP Component Consumption database tableCPPETDPPackage for iPPETime Dependent Process Parameter
/SAPAPO/TISASDLHIDoc Data: Header Forecast/Operative Delivery Schedule/SAPAPO/CMDSCollaborative Management of Delivery Schedules (SD)
/SAPAPO/TISASDLHIDoc Data: Header Forecast/Operative Delivery Schedule/SAPAPO/CMDSCollaborative Management of Delivery Schedules (SD)
/SAPAPO/SORSPLSQSurplus Quantity - Worklist for Approval/SAPAPO/PSORSurplus and Obsolescence Service
/SAPAPO/SORSPLSQSurplus Quantity - Worklist for Approval/SAPAPO/PSORSurplus and Obsolescence Service
/SAPAPO/SORSPLSRSurplus Quantity Reporting/SAPAPO/PSORSurplus and Obsolescence Service
/SAPAPO/SORSPLSRSurplus Quantity Reporting/SAPAPO/PSORSurplus and Obsolescence Service
/SAPAPO/PDEMCALTTrigger table of calendar change (Obsolete)/SAPAPO/PDEMCapture/Manage Demand
CRMC_SRCL_TESTService Clocks: Used to test solutionCRM_SERVICE_CLOCKSCalculate durations/thresholds between various events
CRMD_IC_LTX_LOGSRecord the number of Transaction LaunchesCRM_IC_APPL_SSC_MEASURESSC - Measurement for Pricing based on Usage of Serv. Req
CRMD_ESSC_SVYSSF custom satisfaction survey dataCRM_IC_APPL_SSC_SR_SVYSSC - Service Request Processing
CRMD_IU_DIT_JOBSDetails of Job in DITCRM_IU_CI_DITUtilities Data Import Tool
CRMM_BUPA_MKP_BWService: Business Partner BW Marketing PermissionsCRM_BUPA_MKT_PERMISSIONMarketing PermissionData Set for Business Partner
CRMM_BUPA_MKP_BWService: Business Partner BW Marketing PermissionsCRM_BUPA_MKT_PERMISSIONMarketing PermissionData Set for Business Partner
COMM_IL_SCCRSMaster Data of Relationship Type: Cross SellingCRM_CFG_SC_ILInterlinkages used in Solution Configurator
COMM_IL_SCCRSMaster Data of Relationship Type: Cross SellingCRM_CFG_SC_ILInterlinkages used in Solution Configurator
COMM_IL_SCCRS_HHistorical Data of Relationship Type: Cross SellingCRM_CFG_SC_ILInterlinkages used in Solution Configurator
COMM_IL_SCCRS_HHistorical Data of Relationship Type: Cross SellingCRM_CFG_SC_ILInterlinkages used in Solution Configurator
COMM_IL_SCDECMaster Data of Relationship Type: Dependent ComponentsCRM_CFG_SC_ILInterlinkages used in Solution Configurator
COMM_IL_SCDECMaster Data of Relationship Type: Dependent ComponentsCRM_CFG_SC_ILInterlinkages used in Solution Configurator
COMM_IL_SCDEC_HHistorical Data of Relationship Type: Dependent ComponentsCRM_CFG_SC_ILInterlinkages used in Solution Configurator
COMM_IL_SCDEC_HHistorical Data of Relationship Type: Dependent ComponentsCRM_CFG_SC_ILInterlinkages used in Solution Configurator
COMM_IL_SCSLCMaster Data for the Sales Bundle Relationship TypeCRM_CFG_SC_ILInterlinkages used in Solution Configurator
COMM_IL_SCSLCMaster Data for the Sales Bundle Relationship TypeCRM_CFG_SC_ILInterlinkages used in Solution Configurator
COMM_IL_SCSLC_HHistorical Data for the Sales Bundle Relationship TypeCRM_CFG_SC_ILInterlinkages used in Solution Configurator
COMM_IL_SCSLC_HHistorical Data for the Sales Bundle Relationship TypeCRM_CFG_SC_ILInterlinkages used in Solution Configurator
COMM_IL_SCUPSMaster Data of Relationship Type: Up-Selling for TelcoCRM_CFG_SC_ILInterlinkages used in Solution Configurator
COMM_IL_SCUPSMaster Data of Relationship Type: Up-Selling for TelcoCRM_CFG_SC_ILInterlinkages used in Solution Configurator
COMM_IL_SCUPS_HHistorical Data of Relationship Type: Up-Selling for TelcoCRM_CFG_SC_ILInterlinkages used in Solution Configurator
COMM_IL_SCUPS_HHistorical Data of Relationship Type: Up-Selling for TelcoCRM_CFG_SC_ILInterlinkages used in Solution Configurator
COMM_IL_PKGITMMaster Data of Relationship Type Bundle ComponentCRMS4_PRDPKGS4CRM: General Data for Product Bundle
COMM_IL_PKGITMMaster Data of Relationship Type Bundle ComponentCRMS4_PRDPKGS4CRM: General Data for Product Bundle
COMM_IL_PKGITM_HHistorical Data of Relationship Type Bundle ComponentCRMS4_PRDPKGS4CRM: General Data for Product Bundle
COMM_IL_PKGITM_HHistorical Data of Relationship Type Bundle ComponentCRMS4_PRDPKGS4CRM: General Data for Product Bundle
/LIME/CODE_RELTrigger for LIME Code Generation/LIME/PLT_UTILUtilities
/PLMB/NAV_SETVARNAV - User Specific Navigator Setting Variants/PLMB/BA_NAVBase: PLM Object Navigator
/IPRO/TCUSTELMDocument Builder Custom Elements/IPRO/BASISTables, Structures, general Infrastruktur
/IPRO/TUR_LOGUpdate Report Log for Batch Processing/IPRO/BASISTables, Structures, general Infrastruktur
/IPRO/TVAR_CMPVariable table/IPRO/BASISTables, Structures, general Infrastruktur
AXT_EXT_GENTo be generated extensionAXT_MODELApplication Extensibility Tool: Model
BSSP_FEEDBACK_TRDatabase table for BSSP_FEEDBACK (SAP GUI transactions)BSSPDGeneric Content: Tagging, End User Feedback etc.
BSSP_FEEDBACK_WDDatabase table for BSSP_FEEDBACK (WD applications)BSSPDGeneric Content: Tagging, End User Feedback etc.
BSSOA_CHK_DATCFGConfiguration values for BS_SOA checksBS_SOA_REUSE_CHECKSBusiness Suite SOA: Checks
BSSOA_PROPConfiguration table for SOA checksBS_SOA_REUSE_CHECKSBusiness Suite SOA: Checks
BSSOA_PROPConfiguration table for SOA checksBS_SOA_REUSE_CHECKSBusiness Suite SOA: Checks
CMS_BII_PP_APPLPCMS-Basel II: Data Extr. Application Params for Parall. ProcCMS_BASELBasel II
CMS_BII_PP_APPLPCMS-Basel II: Data Extr. Application Params for Parall. ProcCMS_BASELBasel II
T77HAP_ASSIGNExternal Objectes Assigned to Template ElementsPAOC_HAP_TEMPLATEAppraisal Templates
T77HAP_ASSIGNExternal Objectes Assigned to Template ElementsPAOC_HAP_TEMPLATEAppraisal Templates
TPCDATEPeriods for Authorization CheckBF_AUTHSpecial Authorization Check (Tax Reduction Law)
TPCDATEPeriods for Authorization CheckBF_AUTHSpecial Authorization Check (Tax Reduction Law)
TPCDATENPeriods for Authorization CheckBF_AUTHSpecial Authorization Check (Tax Reduction Law)
TPCDATENPeriods for Authorization CheckBF_AUTHSpecial Authorization Check (Tax Reduction Law)
RMPSPRO_DP_BATCHPRO: POID that cannot be changedRMPSPRO_DISPOSALPRO Disposal
RMPSPRO_DP_BATCHPRO: POID that cannot be changedRMPSPRO_DISPOSALPRO Disposal
RMPSTNA_RULEBASETNA: Schedules for the Disposal According to PRO StandardRMPSPRO_DISPOSALPRO Disposal
FSPP_DEMODemo Data for FSPPFS_FND_PP_SERVICESPP Services
DNOD_NOTIF_TANotification: Data for Task PlanningDNONotifications
DNOD_NOTIF_TANotification: Data for Task PlanningDNONotifications
DNOD_NOTIF_TANotification: Data for Task PlanningDNONotifications
DDLOADHR3load-header table for migrationSBATBASIS System Tables
GUI_E2E_XMLTable for storing BusinessTransaction.xmlSBACKernel Objects
SCI_HANA_TEST1_EDirectory of Repository ObjectsS_CODE_INSPECTORABAP Source Code Analysis
SCI_HANA_TEST2_ESingle Record BufferingS_CODE_INSPECTORABAP Source Code Analysis
SCI_HANA_TST2A_EGeneric BufferingS_CODE_INSPECTORABAP Source Code Analysis
SCI_HANA_TST2B_EFully BufferedS_CODE_INSPECTORABAP Source Code Analysis
RNDPGSCANRESULTTestSABPABAP Runtime Environment
SCR_ABAP_ASTCL_ABAP_COMPILER: Analysis StructureSABP_COMPILERABAP Compiler
SCR_ABAP_ASTCL_ABAP_COMPILER: Analysis StructureSABP_COMPILERABAP Compiler
SCR_ABAP_AST_ETestSABP_COMPILERABAP Compiler
SCR_ABAP_SCANScan ResultsSABP_COMPILERABAP Compiler
SCR_ABAP_SCAN_ETestSABP_COMPILERABAP Compiler
SCR_ABAP_SYMBScan ResultsSABP_COMPILERABAP Compiler
SCR_ABAP_SYMB_ETestSABP_COMPILERABAP Compiler
SCI_CALL_GRAPHCode Inspector: Call GraphS_CODE_INSPECTOR_TESTS_LACode Inspector tests related to the ABAP language
SCI_CALL_GRAPH_HCode Inspector: Call GraphS_CODE_INSPECTOR_TESTS_LACode Inspector tests related to the ABAP language
SCI_PROG_INFOInfo.S_CODE_INSPECTOR_TESTS_LACode Inspector tests related to the ABAP language
SLIN_CACHE_00Cache Storage for Slin ResultsSLIN_INTERNInternal Use for SLIN (changes made without discussion)
SLIN_CACHE_01Cache Storage for Slin ResultsSLIN_INTERNInternal Use for SLIN (changes made without discussion)
SLIN_CACHE_02Cache Storage for Slin ResultsSLIN_INTERNInternal Use for SLIN (changes made without discussion)
SLIN_CACHE_03Cache Storage for Slin ResultsSLIN_INTERNInternal Use for SLIN (changes made without discussion)
SLIN_CACHE_04Cache Storage for Slin ResultsSLIN_INTERNInternal Use for SLIN (changes made without discussion)
SLIN_CACHE_05Cache Storage for Slin ResultsSLIN_INTERNInternal Use for SLIN (changes made without discussion)
SLIN_CACHE_06Cache Storage for Slin ResultsSLIN_INTERNInternal Use for SLIN (changes made without discussion)
SLIN_CACHE_07Cache Storage for Slin ResultsSLIN_INTERNInternal Use for SLIN (changes made without discussion)
SLIN_CACHE_08Cache Storage for Slin ResultsSLIN_INTERNInternal Use for SLIN (changes made without discussion)
SLIN_CACHE_09Cache Storage for Slin ResultsSLIN_INTERNInternal Use for SLIN (changes made without discussion)
SLIN_CACHE_10Cache Storage for Slin ResultsSLIN_INTERNInternal Use for SLIN (changes made without discussion)
SLIN_CACHE_11Cache Storage for Slin ResultsSLIN_INTERNInternal Use for SLIN (changes made without discussion)
SLIN_CACHE_12Cache Storage for Slin ResultsSLIN_INTERNInternal Use for SLIN (changes made without discussion)
SLIN_CACHE_13Cache Storage for Slin ResultsSLIN_INTERNInternal Use for SLIN (changes made without discussion)
SLIN_CACHE_14Cache Storage for Slin ResultsSLIN_INTERNInternal Use for SLIN (changes made without discussion)
SLIN_CACHE_VERSStorage for SLIN Version FlagsSLIN_INTERNInternal Use for SLIN (changes made without discussion)
DAAG_TEMP_DATATemporary Storage for Dates and Row CountS_DAAG_PARTITIONINGPartitioning Management
ALDTSCACHESDTS: Current/Next Downtimes for CCMS Systems/InstancesSCSMCCMS Central System Management
ALDTSCACHESDTS: Current/Next Downtimes for CCMS Systems/InstancesSCSMCCMS Central System Management
CFONT_MAINLOGI18N:Cascading font, log tableSPOOL_CASCADING_FONTSCascading Fonts Configurator
SDM_SUM_01Test table for SDM in SUMSDM_TEST_SUMTest objects for SUM
SDM_SUM_02Test table for SDM in SUMSDM_TEST_SUMTest objects for SUM
SDM_SUM_03Test table for SDM in SUMSDM_TEST_SUMTest objects for SUM
SDM_SUM_04Test table for SDM in SUMSDM_TEST_SUMTest objects for SUM
TRACE_COCKPITTable for RSMONTRACE_COCKPITSTSKTask Handler, Number Range, Update, Gateway and so on
SNHI_DU_PROXYHANA Integration: Proxy for a HANA Delivery UnitSNHI_DELIVERY_UNIT_PROXYHANA Integraton: Delivery Unit Proxy
SNHI_DU_PROXYHANA Integration: Proxy for a HANA Delivery UnitSNHI_DELIVERY_UNIT_PROXYHANA Integraton: Delivery Unit Proxy
GTABKEY_REPOSRepository metadata for gCTSSCTS_GTABKEY_SERVERGTABKEY: Global Table Key Registration (server part)
CMSALOGARCMS Action LogSCMAChange Management Server
CMSALOGTCMS Action LogSCMAChange Management Server
DB2LODLKRFC - Deadlock TableSTU3Development Class for Database Monitor
DB2LODRSRFC - Deadlock ResourcesSTU3Development Class for Database Monitor
DB2LOTHWRFC - Timeout Waiter and HolderSTU3Development Class for Database Monitor
DB2LOTRSRFC - Timeout ResourcesSTU3Development Class for Database Monitor
DB2LRURRFC - Long Running URsSTU3Development Class for Database Monitor
DB2TBLXRFC - Table ExtentsSTU3Development Class for Database Monitor
DDCNVSTATStatistical Data for ConversionSICNIncremental Conversion and Tools
DDSTATHISTStatistical Data for ConversionSICNIncremental Conversion and Tools
LCA_PROSESProfiling-SessionsSLCAPPSliveCache Applications
LCINIT_LOGLog Entries: Start/Stop/Init of Prep./Postprocessing ReportsSLVCliveCache CCMS
LCINIT_LOGLog Entries: Start/Stop/Init of Prep./Postprocessing ReportsSLVCliveCache CCMS
STERM_REL_TERMRetired termsSTERMSAPterm Terminology Database
LXE_MLTR_IMPMLTR import headerSLXENew MLT Environment
LXE_MLTR_IMPMLTR import headerSLXENew MLT Environment
LXE_MLTR_IMP_OBJMLTR import object logSLXENew MLT Environment
LXE_TERMO_DATATerMo DataSLXE_TERMOTerminology Monitor
CRMCHKCSNShort Desc.: Related TicketS_CHECK_RESULT_MANAGEMENT_OBSLSTRICTELY FORBIDDEN: Outdated stuff nominated for deletaion
CRMCHKCSNShort Desc.: Related TicketS_CHECK_RESULT_MANAGEMENT_OBSLSTRICTELY FORBIDDEN: Outdated stuff nominated for deletaion
AKB_FREEZEFrozen Basis Objects for Backwards-Compatible Basis (AKB)SPAK_AKBDownward Compatible Development
AKB_FREEZE_EXTFrozen Basis Objects for Backwards-Compatible Basis (AKB)SPAK_AKBDownward Compatible Development
PAKPARAM_LOGPackage Parameters TableSPAK_APIPackage API
SCRP_UTIL_TODTObsoleteSCRP_UTILScreen Painter: Utilities
RLB_DB_TRReuse Library - Don't use itSRLBReuse Library
RLB_DB_TRReuse Library - Don't use itSRLBReuse Library
RLB_DB_TRReuse Library - Don't use itSRLBReuse Library
RLB_DB_TRReuse Library - Don't use itSRLBReuse Library
CLS_RUNRun directorySPAK_API_CLASSIFICATIONAPI for Classification Tool Set
CLS_RUN_ASSGNMNTClassifications of objects in a result listSPAK_API_CLASSIFICATIONAPI for Classification Tool Set
CLS_RUN_COUNTERSResult of condition checksSPAK_API_CLASSIFICATIONAPI for Classification Tool Set
CLS_RUN_DISTRNumber of classifications that have a specific valueSPAK_API_CLASSIFICATIONAPI for Classification Tool Set
CLS_RUN_OBJECTSObjects that passed the condition checkSPAK_API_CLASSIFICATIONAPI for Classification Tool Set
CLS_RUN_PARAMSRun directorySPAK_API_CLASSIFICATIONAPI for Classification Tool Set
VFS_FAV_LISTSObject FavoritesSRIS_OBJECT_FAVORITESObject Favorites
VFS_FAV_OBJECTSObject FavoritesSRIS_OBJECT_FAVORITESObject Favorites
/BOBF/CONF_CHKEXBOPF Configuration Check Exceptions/BOBF/CONFIGURATIONBusiness Object Processing Configuration
/BOBF/CONF_CHKEXBOPF Configuration Check Exceptions/BOBF/CONFIGURATIONBusiness Object Processing Configuration
SADL_RS_BASESLRYSADL Reference Scenario Temporal Employee Base SalarySADL_ENTITY_REFERENCE_SCENARIOSADL Entity reference scenario
SADL_RS_BASESLRYSADL Reference Scenario Temporal Employee Base SalarySADL_ENTITY_REFERENCE_SCENARIOSADL Entity reference scenario
SADL_RS_BUDGETSADL Reference Scenario Temporal BudgetSADL_ENTITY_REFERENCE_SCENARIOSADL Entity reference scenario
SADL_RS_BUDGETSADL Reference Scenario Temporal BudgetSADL_ENTITY_REFERENCE_SCENARIOSADL Entity reference scenario
SADL_RS_DEPARTMSADL Reference Scenario Temporal DepartmentSADL_ENTITY_REFERENCE_SCENARIOSADL Entity reference scenario
SADL_RS_DEPARTMSADL Reference Scenario Temporal DepartmentSADL_ENTITY_REFERENCE_SCENARIOSADL Entity reference scenario
SADL_RS_EMPLOYEESADL Reference Scenario Temporal EmployeeSADL_ENTITY_REFERENCE_SCENARIOSADL Entity reference scenario
SADL_RS_EMPLOYEESADL Reference Scenario Temporal EmployeeSADL_ENTITY_REFERENCE_SCENARIOSADL Entity reference scenario
SADL_RS_EVENTSSADL Reference Scenario EventsSADL_ENTITY_REFERENCE_SCENARIOSADL Entity reference scenario
SRT_LPLogical PortsSOAP_LPREGLogical Port Registry
SRT_LPLogical PortsSOAP_LPREGLogical Port Registry
WSRM_DOMAIN_SEQNWSRM: Assignment of Domain Name, Sequence Name, and SIDSOAP_WSRMWSRM: Implementation of WSRM Protocol
SITSUSAGELOGITS: Recording of Usage Log DataS_ITSPITS Plug-In
SITS_AWRT_DEBUGDebugging Entries for Function Group AWRTS_ITSPITS Plug-In
EUP_BSP_IV_CTXTemp table to hold the input value context.S_EUP_GPDevelopment GP
EUP_BSP_OV_CTXTable for bsp co output data. Used by j2ee to get the outputS_EUP_GPDevelopment GP
TCPT2Code Page Texts: Help Table 2SCPSAP Code Pages
UMGMAINLOGSPUMG: Main Log tableSUMIGUnicode Migration: Tabellen Umsetzer + Reparatur Tool
ARCHLNK_TOAXYLink Table for ArchiveLink Stores from EOL SystemsS_ARCHLNK_RETENSION_MGMTRetention Management for ArchiveLink Documents
TILM_DESTR_DOBJQDOBJ - Destruction queueS_ARC_DESTRUCTIONILM: Data Destruction
DAS_STORE_TESTILM SRS: Store test - Temporary tableS_ILM_DAS_PERSISTENCYILM SRS: Persistence
TILMSTOREVENTILM DB Store: Event RecordingS_ILM_STOR_DBILM DB Store: Database
TILM_STOR_POOLILM DB Store: Management of Pool TablesS_ILM_STOR_DBILM DB Store: Database
UCONSTATPROTOCOLProtocol of collected statistic data recordsS_UNIFIED_CON_DDICDDIC elements for S_UNIFIED_CON and subpackages
UCON_LOAD_TESTAMC load test tableS_UNIFIED_CON_RUN_TIMERuntime Unified Connectivity
ACMOBJSTATRESHDRACM: Object-Status results - Header tableSACM_COMMONCommon Objects for Access Control Management
ACMOBJSTATRESHDRACM: Object-Status results - Header tableSACM_COMMONCommon Objects for Access Control Management
PRGN_CORRCorrection Table for Modif. Transaction Codes in Area MenusS_PROFGENABAP Role Administration (Profile Generator)
USOB_FLAGSIndicators for SU22, SU24, SU25S_PROFGENABAP Role Administration (Profile Generator)
CLMS_CRP_CMP_RTCloud Reporting: Collector Component Runtime StatisticsSCLMS_CRP_FRAMECloud Management Services: Cloud Reporting Collector Frame
CLMS_CRP_FRAME_PCRP Collector Frame: overall parametersSCLMS_CRP_FRAMECloud Management Services: Cloud Reporting Collector Frame
CLMS_HC_EXEC_LOGLogging fine granular steps of the health check frameworkSCLMS_HC_RUNTIMEHealth Check Runtime
SPH_PDGUIDSAPphone: Planned Call GUID and Server for Get DialerSPH2SAPphone Predictive Dialing Enhancement
FPFDP_AUNIT_SOForm Data Provider for testing Sales Order TableSAFPFDP_TForm Data Provider: Test Objects
LAW2D_RFCACT_PSHSLIM3License Administration Workbench 2.0
LAW2D_RFCACT_PSHSLIM3License Administration Workbench 2.0
LAW2D_RFCRES_PSHLAW 2.0: RFC result table for 'push'-resultsSLIM3License Administration Workbench 2.0
LAW_ENGINEEngine Measurement DataSLIM2License Administration Workbench
LAW_ENGINEEngine Measurement DataSLIM2License Administration Workbench
LAW_ERESTotal Result: Engine Measurement DataSLIM2License Administration Workbench
LAW_ERESTotal Result: Engine Measurement DataSLIM2License Administration Workbench
LAW_RFCERRORLAW: Storing RFC Error MessagesSLIM2License Administration Workbench
TUL_CPUSystem Measurement: Engine Use LogsSLIMSystem Measurement
TUMRES_HIST_PERSResults of System Measuement: User HistorySLIMSystem Measurement
TUREPHistory of the System Evaluation, User and ISSLIMSystem Measurement
TUREPHistory of the System Evaluation, User and ISSLIMSystem Measurement
TUREP_HISTHistory of the System Evaluation, User and ISSLIMSystem Measurement
TUREP_HISTHistory of the System Evaluation, User and ISSLIMSystem Measurement
SNWD_BP_CEIEPM HANA: CEI DG POC - Business Partner Table (non-EPM)S_EPM_HANA_EXT_DDIC_CEIEPM HANA: CEI specific DDIC artifacts
SNWD_BP_CEIEPM HANA: CEI DG POC - Business Partner Table (non-EPM)S_EPM_HANA_EXT_DDIC_CEIEPM HANA: CEI specific DDIC artifacts
SNWD_BP_CEIEPM HANA: CEI DG POC - Business Partner Table (non-EPM)S_EPM_HANA_EXT_DDIC_CEIEPM HANA: CEI specific DDIC artifacts
SNWD_CEI_B2CEPM HANA: CEI DG POC - Business Partner Table (non-EPM)S_EPM_HANA_EXT_DDIC_CEIEPM HANA: CEI specific DDIC artifacts
SNWD_CEI_B2CEPM HANA: CEI DG POC - Business Partner Table (non-EPM)S_EPM_HANA_EXT_DDIC_CEIEPM HANA: CEI specific DDIC artifacts
SNWD_CEI_B2CEPM HANA: CEI DG POC - Business Partner Table (non-EPM)S_EPM_HANA_EXT_DDIC_CEIEPM HANA: CEI specific DDIC artifacts
SNWD_CONTR_CEIEPM HANA: CEI contract dataS_EPM_HANA_EXT_DDIC_CEIEPM HANA: CEI specific DDIC artifacts
SNWD_CONTR_CEIEPM HANA: CEI contract dataS_EPM_HANA_EXT_DDIC_CEIEPM HANA: CEI specific DDIC artifacts
SNWD_CONTR_CEIEPM HANA: CEI contract dataS_EPM_HANA_EXT_DDIC_CEIEPM HANA: CEI specific DDIC artifacts
SNWD_BP_CRMEPM HANA DG: CRM Business Partner Table (non-EPM)S_EPM_HANA_EXT_DDIC_CRMEPM HANA: CRM specific DDIC artifacts
SNWD_BP_CRMEPM HANA DG: CRM Business Partner Table (non-EPM)S_EPM_HANA_EXT_DDIC_CRMEPM HANA: CRM specific DDIC artifacts
SNWD_BP_CRMEPM HANA DG: CRM Business Partner Table (non-EPM)S_EPM_HANA_EXT_DDIC_CRMEPM HANA: CRM specific DDIC artifacts
SNWD_BP_RETAILEPM HANA DG: RETAIL Business Partner TableS_EPM_HANA_EXT_DDIC_RETAILEPM HANA: Reteil DDIC Objects
ECLOG_AIDXeCATT Log Archive - Table for Log Archive IndexSECATT_DDICeCATT ABAP Dictionary Objects
ECLOG_CALLLog Header - Hierarchical Caller InformationSECATT_DDICeCATT ABAP Dictionary Objects
ECLOG_MEMORY_TRCeCATT Trace of Memory UsageSECATT_DDICeCATT ABAP Dictionary Objects
ECWD_RESOURCESeCATT: Database Table for WD Resources (HTML)SECATT_DDICeCATT ABAP Dictionary Objects
ECATT_TEST_TABLETest Table for ABAP Objects Commands in eCATTSECATT_QMeCATT Test Cases
SLS_RTESTPAW - Participant's Aggregated Test ResultsSIWLAsseT Learningscape (PEW) / Knowledge Warehouse
SLS_YTESTPAW - Participant's Aggregated Test ResultsSIWNSAP Learning Solutions / KW - Learning Architecture
DSVAS_STABCopy of structure of table dsvassessadminBDL3Service data download (as of R/3 Release 3.x)
DSVAS_STABCopy of structure of table dsvassessadminBDL3Service data download (as of R/3 Release 3.x)
DSVAS_STABCopy of structure of table dsvassessadminBDL3Service data download (as of R/3 Release 3.x)
DSVAS_STABCopy of structure of table dsvassessadminBDL3Service data download (as of R/3 Release 3.x)
DSVAS_STABCopy of structure of table dsvassessadminBDL3Service data download (as of R/3 Release 3.x)
RSCRMD_IMP_TRACETrace results tableRSCRM_IMP_TEST_TOOLSCRM In-Memory Planning Test Tools
RSDRC_DS_BASE_TCTest Data for RSDRC DS TestRSDRCData Manager InfoProvider Read Access
RSDRC_PART_TCTest Data for RSDRC PartitioningRSDRCData Manager InfoProvider Read Access
RSDRV_ODS_TCDataStore Test Data Without BEXFLRSDRVData Manager Virtual InfoProvider
RSDDTREX_CHKMSGSMessages from the BIA Index CheckRSDDTREXTREX Aggregate
RSPLS_PM_LOGPlanning Modeler: LogRSPLSPlanning: General Services
RSBPCB_INSTBPC: BPF InstanceRSBPCBBPC IP Extension: BPF
RSBPCB_MEM_HIEBPC: BPF Driver Dimension Hierarchy Member ItemRSBPCBBPC IP Extension: BPF
RSBPCB_MEM_HIEBPC: BPF Driver Dimension Hierarchy Member ItemRSBPCBBPC IP Extension: BPF
RSBPCB_MEM_HIEBPC: BPF Driver Dimension Hierarchy Member ItemRSBPCBBPC IP Extension: BPF
RSBPC0_LOGON_ABPC: User Logon Activity HistoryRSBPC0BPC IP Extension: Common Services
RSBPC0_LOGON_ABPC: User Logon Activity HistoryRSBPC0BPC IP Extension: Common Services
RSBPCW_LCK_DIMBPC Work Status - Lock Dimension TableRSBPCWBPC IP Extension: Work Status
RSBPCW_OWNER_HDRBPC Work Status - Owner information header tableRSBPCWBPC IP Extension: Work Status
UPS_CHANGELOGChange Log for StatusUPSStatus and Tracking System
UPS_LINKSLinks to Org. ValuesUPSStatus and Tracking System
UPS_LINKSLinks to Org. ValuesUPSStatus and Tracking System
UPS_LOCKSLock Table for Status and Tracking SystemUPSStatus and Tracking System
RSPSADELDelete PSA request in batchRSSMBW: General monitoring and scheduling
RSCRM_IMP_TRACETrace results tableRSCRM_IMP_TEST_UTILCRM In-Memory Planning Test Utitilites
UJHANA_LOGBPC: HANA LOGBPC_HANA_CORE_UTLBPC HANA Utilities
UJA_LOGGED_ONBPC: User Logon HistoryUJAAdmin
UJA_LOGGED_ON_ABPC: User Logon Activity HistoryUJAAdmin
UJA_LOGGED_ON_ABPC: User Logon Activity HistoryUJAAdmin
UJA_USAGE_LOGBPC: Usage LogUJAAdmin
UJH_WEB_CONT_OBJBPC: Web content ObjectUJHContent Library
UJH_WEB_CONT_OBJBPC: Web content ObjectUJHContent Library
UJH_WEB_CONT_OBJBPC: Web content ObjectUJHContent Library
BPC_LOC_BPC_RUNBPC Localization: BPF OA integration mapping status tableUJ_LOC_CN_BPFBPC localization backend service for China
BPC_LOC_BPC_RUNBPC Localization: BPF OA integration mapping status tableUJ_LOC_CN_BPFBPC localization backend service for China
BPC_LOC_DRV_DIMBPC Localization: BPF mapping for driving dimension tableUJ_LOC_CN_BPFBPC localization backend service for China
BPC_LOC_IDN_DIMBPC Localization: BPF mapping for identity dimention tableUJ_LOC_CN_BPFBPC localization backend service for China
BPC_LOC_TMP_MAPBPC Localization: BPF mapping for template and OA workflowUJ_LOC_CN_BPFBPC localization backend service for China
UJL_LIVEREPORTSBPC: Live report template tableUJLWeb UI (Report, Live Repot)
UJL_LIVEREPORTSBPC: Live report template tableUJLWeb UI (Report, Live Repot)
/SAPAPO/PRF_EXTProfile Extension for Base Profile /SAPAPO/DP440P/SAPAPO/SCMB_FORECASTForecast
/IWFND/D_MET_AGRMetering Data - Aggregated User info and Operation info/IWFND/COS_METSAP GW Framework - Metering
/IWFND/L_METAGRMetering Data - Aggregated Service information - per month/IWFND/COS_METSAP GW Framework - Metering
/IWFND/L_MET_AGRObsolete - Metering Data - Aggregated Info ODC vs. GC/IWFND/COS_METSAP GW Framework - Metering
/IWFND/I_MED_CTCGeneric Cluster Caching for Meta Data (Language-Dependent)/IWFND/MED_PER_DEV_LANGUSAP GW Framework - Metadata - Persistency: Dev. Translation
T5Q_CONSTANTSAustralia-specific Functionalities ConstantsPC13HR accounting: Australia
T5Q_STP_PAYSTP table - Payment detailsPC13HR accounting: Australia
T5D46Flexible Working Hours Policy: Management of Disr.Ev. ITDPB01HR Master Data: Germany
T5D48Flexible Working Hours Policy: Management of Value CreditsPB01HR Master Data: Germany
T5D2IStADUEV Notifications: Transfer NumbersP01THR Germany: Tax
P44_ERR_REPTABAssignement of employee representatives to unionsPC44HR accounting: Finland
P44_ERR_REPTABAssignement of employee representatives to unionsPC44HR accounting: Finland
T5G_DPIRM_DATEGB Archiving Group MethodPB08HR master data: UK
T5G_EYUUPLOADRTI: Upload Table for EYU FormsPC08HR accounting: GB
P2RI_INFO155Structure for infotype 0155 (IT) with datePC15HR payroll: Italy
PA3214HR Master Record: Infotype 3214P15P1HR Public Sector Italy
T7PLU0Quota conversion dataPB46HR Poland
P2PL_CALPayroll Result PL: Allowance CalendarPC46HR Poland
HRPADRU_LN_FNMBFile names and its correspondence to Sickness List Cert.PB33HR master data : Russia
T7RUPACKGRPFR Packages groupPB33HR master data : Russia
P2VE_PS_EVALHRMS-VE: Annual Balance of Profit Share PaymentsPB17HR master data: Venezuela
P2VE_SEN_EVALHRMS-VE: Information on Length of Service PaymentPB17HR master data: Venezuela
T7VEP1Transfer of External Payroll Results: Profit SharePB17HR master data: Venezuela
T7VES5Transfer of External Payroll Results: SeniorityPB17HR master data: Venezuela
HRBW_CNTB_DELTATime stamps for Payroll Reconcilliation ExtractorsBWPY_RECON_EXTPackage for generic Reconciliation objects
HRBW_REC_DTPY-XX-RECON : Country specific reports detailed resultsBWPY_RECONPayroll reconciliation BW extractors
HRBW_REC_DTPY-XX-RECON : Country specific reports detailed resultsBWPY_RECONPayroll reconciliation BW extractors
HRBW_REC_DT_NEWPY-XX-RECON : Country specific reports detailed resultsBWPY_RECON_EXTPackage for generic Reconciliation objects
HRBW_REC_HDPY-XX-RECON: Country specific reports header dataBWPY_RECONPayroll reconciliation BW extractors
HRBW_REC_HDPY-XX-RECON: Country specific reports header dataBWPY_RECONPayroll reconciliation BW extractors
HRBW_REC_HDPY-XX-RECON: Country specific reports header dataBWPY_RECONPayroll reconciliation BW extractors
HRBW_REC_HDPY-XX-RECON: Country specific reports header dataBWPY_RECONPayroll reconciliation BW extractors
T77OMAHQ_GARBAGETable with Selections/Queries to be DeletedPP0EHR-CA: OM New Maintenance
T52_WAGE_SEPARATWage Separation According to DatePCALSAP HR Payroll Application Development
PPDITTransfer to Accounting: Lines in HR IDOCsPCPOPY: Posting Transfer
PYC_D_PY_MSGPYC: payroll messagePCTRRESTransparent Payroll Results: Environment
PYC_D_PY_MSGPYC: payroll messagePCTRRESTransparent Payroll Results: Environment
PYC_D_PY_MSG_JOBPYC: payroll messagePCTRRESTransparent Payroll Results: Environment
PYC_D_PY_MSG_JOBPYC: payroll messagePCTRRESTransparent Payroll Results: Environment
NWBC_USAGE_LOGNWBC: Recording of Usage Log DataSAP_NWBCNetWeaver Business Client
WDR_USAGE_LOGWeb Dynpro: Recording of Usage Log DataSWDP_RUNTIME_COREWeb Dynpro Runtime: Core Functions
SALV_BS_ADMINObsolete (Table for Creating Control Values for ALV)SALV_BS_COMMONPackage SALV_BS_COMMON
FPM_ALV_T_F4Test table F4 helps in ATS and ALV listAPB_FPM_TESTFloorplan Manager (Test applications)
FPM_T_TEST_VHFPM Test table for ATS List, different value helpsAPB_FPM_TESTFloorplan Manager (Test applications)
FXMOMENTSTOREFeedback moments that pushed to clientSUI_FLP_EXT_FXFiori Feedback Integration based on Qualtrics
/ASU/HEADERASU Version Header/ASU/TOOLS_DDICApplication Specific Upgrade: Tools DDIC
/ASU/HEADERASU Version Header/ASU/TOOLS_DDICApplication Specific Upgrade: Tools DDIC
DVM_S4_ANALYSISStore the analysis step execution statusDVM_DDICDDIC Objects for DVM
DVM_S4_ANALYSISStore the analysis step execution statusDVM_DDICDDIC Objects for DVM
/BDL/STABCopy of structure of table dsvassessadmin/BDL/BDL3NAlready existing objects of SDCC in release 4*
/BDL/STABCopy of structure of table dsvassessadmin/BDL/BDL3NAlready existing objects of SDCC in release 4*
/BDL/STABCopy of structure of table dsvassessadmin/BDL/BDL3NAlready existing objects of SDCC in release 4*
/BDL/STABCopy of structure of table dsvassessadmin/BDL/BDL3NAlready existing objects of SDCC in release 4*
/BDL/STABCopy of structure of table dsvassessadmin/BDL/BDL3NAlready existing objects of SDCC in release 4*
/BDL/STAB2Copy of structure of table dsvassessadmin/BDL/TASKMANAGERTask Manager
/BDL/STAB2Copy of structure of table dsvassessadmin/BDL/TASKMANAGERTask Manager
/BDL/STAB2Copy of structure of table dsvassessadmin/BDL/TASKMANAGERTask Manager
/BDL/STAB2Copy of structure of table dsvassessadmin/BDL/TASKMANAGERTask Manager
/BDL/STAB2Copy of structure of table dsvassessadmin/BDL/TASKMANAGERTask Manager
/SDF/CLI_TRCTable for storing BusinessTransaction.xml/SDF/STPI_6XRelease 6.XX dependent Basis Addon SLM
/SDF/CMO_T_62BCCMC Service: Period/SDF/STPI_DDICDDIC for /SDF/STPI Development
/SDF/CMO_T_62BCCMC Service: Period/SDF/STPI_DDICDDIC for /SDF/STPI Development
/SDF/CMO_T_DBCMO serviee: Database growth/SDF/STPI_DDICDDIC for /SDF/STPI Development
/SDF/MON_HEADERMonitoring Data/SDF/STPI_6XRelease 6.XX dependent Basis Addon SLM
/SDF/OI_LOGLog table for Online Import Check/SDF/STPI_DDICDDIC for /SDF/STPI Development
/SDF/DRM_RESULTSData Readyness Monitoring - Results/SDF/STPI_7X7.x developments in ST-PI
/SDF/DRM_RESULTSData Readyness Monitoring - Results/SDF/STPI_7X7.x developments in ST-PI
/SDF/DRM_RES_DEData Readyness Monitoring - Results Details/SDF/STPI_7X7.x developments in ST-PI
/SDF/DRM_RES_DEData Readyness Monitoring - Results Details/SDF/STPI_7X7.x developments in ST-PI
/SDF/DRM_RES_DEData Readyness Monitoring - Results Details/SDF/STPI_7X7.x developments in ST-PI
/SDF/DRM_RES_DEData Readyness Monitoring - Results Details/SDF/STPI_7X7.x developments in ST-PI
/SDF/HDB_DBCONMemory of Checked DB Connections to HDBs/SDF/STPI_7X7.x developments in ST-PI
Privacy Policy