WAERS - Currency Key

SAP data element WAERS has the title "Currency Key".
It is part of development package BF in software component CA-BK. This development package consists of objects that can be grouped under "FI Cross-application Objects".

Properties of data element WAERS

Property
DomainWAERS
Data TypeCUKY
Length5
Decimals0
Output Length5
Supports lower caseNo
Conversion Routine
Short DescriptionCurrency
Medium DescriptionCurrency
Long DescriptionCurrency

Tables with fields of type WAERS

The data element WAERS is used by fields in the following tables.

Table
Development Package
/ISDFPS/CS_EXLSTException List: Overwritten Purchase Requisitions/ISDFPS/MM_CSDFPS Enhancements MM (Cross System)
/ISDFPS/TL1Task List - Operation/Activity/ISDFPS/UPS_EXTENSIONS_ASSETAsset Objects in UPS
T7CNTPM_ITMTYPTotal Payment Management: Item TypePAOC_PAY_CN_TPMAdd-On Development Total Payment Management China
T7CNTPM_USAGETPM: Usage DataPAOC_PAY_CN_TPMAdd-On Development Total Payment Management China
HRP1689DB Table for Infotype 1689LSO_P99S_TNM_SFWS_UI_01Switch Training Needs Management for LSO - User Interface
HRP1689DB Table for Infotype 1689LSO_P99S_TNM_SFWS_UI_01Switch Training Needs Management for LSO - User Interface
HRP1689DB Table for Infotype 1689LSO_P99S_TNM_SFWS_UI_01Switch Training Needs Management for LSO - User Interface
HRP1689DB Table for Infotype 1689LSO_P99S_TNM_SFWS_UI_01Switch Training Needs Management for LSO - User Interface
HRP1689DB Table for Infotype 1689LSO_P99S_TNM_SFWS_UI_01Switch Training Needs Management for LSO - User Interface
HRP1689DB Table for Infotype 1689LSO_P99S_TNM_SFWS_UI_01Switch Training Needs Management for LSO - User Interface
HRP1689DB Table for Infotype 1689LSO_P99S_TNM_SFWS_UI_01Switch Training Needs Management for LSO - User Interface
HRP1689DB Table for Infotype 1689LSO_P99S_TNM_SFWS_UI_01Switch Training Needs Management for LSO - User Interface
HRP1689DB Table for Infotype 1689LSO_P99S_TNM_SFWS_UI_01Switch Training Needs Management for LSO - User Interface
T77WWW_INFAPAdditional Payments ConfigurationPAOC_ESS_REP_INESS: Reporting scenarios IN parts
T77WWW_EAWTCWage, Currency & Settlement Type for Pecuniary Item / TaskPAOC_ESEP_COREE-Separation Application: Core Components
T77WWW_TEATOChecklist Clearing DataPAOC_ESEP_COREE-Separation Application: Core Components
T77WWW_TEATOChecklist Clearing DataPAOC_ESEP_COREE-Separation Application: Core Components
PA0906HR Master Record: Infotype 0906PAOC_PAD_IN_PSHR IN: India Public Sector
PA3743HR Master Record: Infotype 3743PAOC_PAD_IN_PSHR IN: India Public Sector
PA3743HR Master Record: Infotype 3743PAOC_PAD_IN_PSHR IN: India Public Sector
PA3743HR Master Record: Infotype 3743PAOC_PAD_IN_PSHR IN: India Public Sector
PA3743HR Master Record: Infotype 3743PAOC_PAD_IN_PSHR IN: India Public Sector
PA3743HR Master Record: Infotype 3743PAOC_PAD_IN_PSHR IN: India Public Sector
PA3743HR Master Record: Infotype 3743PAOC_PAD_IN_PSHR IN: India Public Sector
PA3743HR Master Record: Infotype 3743PAOC_PAD_IN_PSHR IN: India Public Sector
PA3743HR Master Record: Infotype 3743PAOC_PAD_IN_PSHR IN: India Public Sector
PA3743HR Master Record: Infotype 3743PAOC_PAD_IN_PSHR IN: India Public Sector
PA3743HR Master Record: Infotype 3743PAOC_PAD_IN_PSHR IN: India Public Sector
PA3743HR Master Record: Infotype 3743PAOC_PAD_IN_PSHR IN: India Public Sector
PA3743HR Master Record: Infotype 3743PAOC_PAD_IN_PSHR IN: India Public Sector
PA3743HR Master Record: Infotype 3743PAOC_PAD_IN_PSHR IN: India Public Sector
PA3743HR Master Record: Infotype 3743PAOC_PAD_IN_PSHR IN: India Public Sector
PA3743HR Master Record: Infotype 3743PAOC_PAD_IN_PSHR IN: India Public Sector
PA3743HR Master Record: Infotype 3743PAOC_PAD_IN_PSHR IN: India Public Sector
PA3743HR Master Record: Infotype 3743PAOC_PAD_IN_PSHR IN: India Public Sector
T7INLOAN_TRNSDTLoans Specific DataPAOC_PAD_IN_LOANHR IN:Company Loans
T7INREPAY_TRNSRepayment Specific dataPAOC_PAD_IN_LOANHR IN:Company Loans
TJPESS_PERKM_AMTJP ESS IT0559 Per KM Amount SettingPAOC_ASR_PROCESS_CONTENT_JPProcesses: Content Sample Delivery (JP Processes)
TJPESS_PKMAMT_CCESS JP: IT0559 - Amount Per KM By Company CodePAOC_ASR_PROCESS_CONTENT_JPProcesses: Content Sample Delivery (JP Processes)
TJPESS_PKMAMT_NAESS JP: IT0559 - Amount Per KM By National AveragePAOC_ASR_PROCESS_CONTENT_JPProcesses: Content Sample Delivery (JP Processes)
TJPESS_PKMAMT_PSESS JP: IT0559 - Amount Per KM By Per. Area and SubareaPAOC_ASR_PROCESS_CONTENT_JPProcesses: Content Sample Delivery (JP Processes)
T77PAYMX_CFDI_CECFDi CE Digital Tax StampPAOC_PAY_MX_RPAdd-on development payroll Mexico reporting
T5LESESS Malaysia: TP1 TP2PAOC_ESS_ITDCL_MYESS: HR IN - Scenario for Tax Declaration
HRPADNLP_LOG0015NL Pens: infortype 0015 log for Payroll ProcessPAOC_PAY_NL_PENSAdd-On Payroll Development: - Netherlands (Pensions)
HRPADNLP_LOGIMMENL Pens: Immediate Payments - log for Payroll ProcessPAOC_PAY_NL_PENSAdd-On Payroll Development: - Netherlands (Pensions)
HRPADNLP_P2RX_BTPayroll Results: Bank TransfersPAOC_PAY_NL_PENSAdd-On Payroll Development: - Netherlands (Pensions)
HRPADNLP_P2RX_RTPayroll Results: Results TablePAOC_PAY_NL_PENSAdd-On Payroll Development: - Netherlands (Pensions)
HRPADNLP_P2RX_RTPayroll Results: Results TablePAOC_PAY_NL_PENSAdd-On Payroll Development: - Netherlands (Pensions)
HRPADNLP_P2RX_VRPayroll Status InformationPAOC_PAY_NL_PENSAdd-On Payroll Development: - Netherlands (Pensions)
T5UPBSPA24Default CPDF Value TablePAOC_PAD_US_FDUS Federal Public Sector
PTRV_FUEL_TYP_PRTable for Fuel Type and PricesGLO_TRAVEL_GENLocalization Travel Management General Functionality
PTRV_ROUND_WAERSTable for Rounding Rules in CountriesGLO_TRAVEL_GENLocalization Travel Management General Functionality
FITV_HINZ_WERB_BAdditional Amounts and Income-Related Expenses for ReceiptsPTRAPSSpec. Application Dev. Travel Management Public Sector
FITV_HINZ_WERB_SAdditional Amounts and Income-Related ExpensesPTRAPSSpec. Application Dev. Travel Management Public Sector
FITV_MEAL_ACCOMAdditional Amounts for Meals in Accommodations ReceiptsPTRAPSSpec. Application Dev. Travel Management Public Sector
PTRV_COMM_AMTDetail Data: Transfer to FM When Trip SavedPTRAPSSpec. Application Dev. Travel Management Public Sector
PTRV_COMPComparison Calculation Results PSPTRAPSSpec. Application Dev. Travel Management Public Sector
PTRV_SCOMTravel Statistic - Request/Plan/Settlement Cost ComparisonPTRA_ADDONTravel Management Add-On
PTRV_VERSIONHistory TablePTRA_ADDONTravel Management Add-On
T706_COST_CPCost Comparison on Trip Level: Maximum DifferencePTRA_ADDONTravel Management Add-On
HRP5010Database Table for Infotype 5010PAOC_HCP_DATACOLLECTIONHCP Data Collection
PA0666HR Master Record Infotype 0666PAOC_HCP_DATACOLLECTIONHCP Data Collection
T77HCP_LIMICost Item LimitsPAOC_HCP_CUSTOMIZINGHCP Customizing
T77HCP_VALUValuation of Non-Valuated Cost ItemsPAOC_HCP_CUSTOMIZINGHCP Customizing
T71ADM_EE_HISTCompensation Tracking for EmployeesPAOC_ECM_ADM_PLANNING_OVERVIEWCompensation Planning Overview
T71ADM_SPENT_AMTCompensation Planning: Spent AmountsPAOC_ECM_ADM_PLANNING_OVERVIEWCompensation Planning Overview
PA0759HR Master Record: Infotype 0759 (Compensation Process)PAOC_ECM_ADM_BLCompensation Administration - Business Logic
T71ADM03Compensation Plan AttributesPAOC_ECM_ADM_BLCompensation Administration - Business Logic
T71ADM17Compensation GuidelinePAOC_ECM_ADM_BLCompensation Administration - Business Logic
T71ADM18Compensation Guideline Proration RulePAOC_ECM_ADM_BLCompensation Administration - Business Logic
T71ADM23Compensation Matrix ValuesPAOC_ECM_ADM_BLCompensation Administration - Business Logic
T71ADM25Rounding Formula DefinitionsPAOC_ECM_ADM_BLCompensation Administration - Business Logic
HRP1271DB Table for Infotype 1271PAOC_ECM_JPR_BLJob Pricing - Business Logic
T71JPR07Survey General DataPAOC_ECM_JPR_BLJob Pricing - Business Logic
T71JPR25Salary Range AdjustmentPAOC_ECM_JPR_BLJob Pricing - Business Logic
PA0761HR Master Record: Infotype 0761 (LTI Grant)PAOC_ECM_LTI_BLLong Term Incentive Plans - Business Logic
PA0762HR Master Record: Infotype 0762 (LTI Exercising)PAOC_ECM_LTI_BLLong Term Incentive Plans - Business Logic
T71LTI03LTI Plan Pricing InformationPAOC_ECM_LTI_BLLong Term Incentive Plans - Business Logic
T71LTI06Conversion of Stock UnitsPAOC_ECM_LTI_BLLong Term Incentive Plans - Business Logic
HRESS_D_CATS_FAVCATS Favorites: database tablePAOC_CATS_ESS_WDACATS Application
T7INPEI1P2E: Policy Master TablePAOC_PAD_IN_P2E_APIHR Policy Management API Objects � India
T7INPEX1P2E: Request transactional dataPAOC_PAD_IN_P2E_APIHR Policy Management API Objects � India
T7INPEX1P2E: Request transactional dataPAOC_PAD_IN_P2E_APIHR Policy Management API Objects � India
T7INPEX1P2E: Request transactional dataPAOC_PAD_IN_P2E_APIHR Policy Management API Objects � India
T7INPEX1P2E: Request transactional dataPAOC_PAD_IN_P2E_APIHR Policy Management API Objects � India
T7INPEX1P2E: Request transactional dataPAOC_PAD_IN_P2E_APIHR Policy Management API Objects � India
T7INPEX2P2E: Request transactional data (For Multi line )PAOC_PAD_IN_P2E_APIHR Policy Management API Objects � India
T7INPEX2P2E: Request transactional data (For Multi line )PAOC_PAD_IN_P2E_APIHR Policy Management API Objects � India
T7INPEX2P2E: Request transactional data (For Multi line )PAOC_PAD_IN_P2E_APIHR Policy Management API Objects � India
T7INPEX2P2E: Request transactional data (For Multi line )PAOC_PAD_IN_P2E_APIHR Policy Management API Objects � India
T7INPEX2P2E: Request transactional data (For Multi line )PAOC_PAD_IN_P2E_APIHR Policy Management API Objects � India
T7INPEX3P2E: Request transactional data (For Multi line )PAOC_PAD_IN_P2E_APIHR Policy Management API Objects � India
T7INPEX3P2E: Request transactional data (For Multi line )PAOC_PAD_IN_P2E_APIHR Policy Management API Objects � India
T7INPEX3P2E: Request transactional data (For Multi line )PAOC_PAD_IN_P2E_APIHR Policy Management API Objects � India
T7INPEX3P2E: Request transactional data (For Multi line )PAOC_PAD_IN_P2E_APIHR Policy Management API Objects � India
T7INPEX3P2E: Request transactional data (For Multi line )PAOC_PAD_IN_P2E_APIHR Policy Management API Objects � India
HRFPM_BPREP_DATAPreprocesses Data for BPREP Data ExtractionPAOC_FPM_COM_ENGINEPosition Management: Commitment Creation
HRFPM_DIFFERENCEHRFPM: Personnel Costs Savings/ OverrunPAOC_FPM_COM_ENGINEPosition Management: Commitment Creation
HRFPM_FM_POSHRFPM: FM Documents - ItemsPAOC_FPM_COM_ENGINEPosition Management: Commitment Creation
HRFPM_FM_POSHRFPM: FM Documents - ItemsPAOC_FPM_COM_ENGINEPosition Management: Commitment Creation
HRFPM_FM_POS_BUHRFPM: FM Documents - Items for BudgetPAOC_FPM_COM_ENGINEPosition Management: Commitment Creation
HRFPM_FPM_POSHRFPM: FPM Documents - ItemsPAOC_FPM_COM_ENGINEPosition Management: Commitment Creation
HRFPM_FPM_POSHRFPM: FPM Documents - ItemsPAOC_FPM_COM_ENGINEPosition Management: Commitment Creation
HRFPM_FPM_POS_BUHRFPM: FPM Documents - Items for BudgetPAOC_FPM_COM_ENGINEPosition Management: Commitment Creation
HRFPM_OBJECTSHRFPM: Object table of the commitment enginePAOC_FPM_COM_ENGINEPosition Management: Commitment Creation
PA3293HR Master Record for Infotype 3293PAOC_FPM_FTEPosition Management: Full-Time Equivalents
T77HRFPM_PCS_02Consolidation RulesPAOC_FPM_CUSTOMIZINGPosition Management: Customizing
T76MGE_ACPIDerived Compensation Package ItemsPAOC_PAD_MGEManagement Of Global Employees
T76MGE_CPI_NCompensation Package ItemsPAOC_PAD_MGEManagement Of Global Employees
T76MGE_CPI_NCompensation Package ItemsPAOC_PAD_MGEManagement Of Global Employees
T5UEFFR_BUND_RECTemporary storage of Bundled records in Effort CertificationPAOC_PAD_US_EFRHR USA: Effort Reporting
T77SFEC_CURRCurrency of Wage TypePAOC_PAD_SE_SFECService Enabling Employee Central Integration
T77SFEC_CURRCurrency of Wage TypePAOC_PAD_SE_SFECService Enabling Employee Central Integration
TPTCOR_APLDifferent Payment (Correction Scenario)PAOC_TIM_CORRECTION_REQCorrection Scenario: Enhancements for Database of Requests
T77WWW_ELIGIBLEEmployee Eligibility for Advanced ClaimsPAOC_PAD_ADVCLMSAdvanced Claims
PYC_D_BPC_REJOMBatch Processing Component Reject Object MessagesPAOC_PAY_PYD_PCC_CONTPayroll Control Center Content
PYC_D_BPC_REJOMBatch Processing Component Reject Object MessagesPAOC_PAY_PYD_PCC_CONTPayroll Control Center Content
PYC_D_BPC_REJOMBatch Processing Component Reject Object MessagesPAOC_PAY_PYD_PCC_CONTPayroll Control Center Content
PYC_D_BPC_REJOMBatch Processing Component Reject Object MessagesPAOC_PAY_PYD_PCC_CONTPayroll Control Center Content
FIAPSAC_PORULESPayment Order RulesGLO_FIN_FI_SADevelopments for Saudi Arabia
FIAPSAD_ADP_HDEmployee's Advance Payment Request Header DataGLO_FIN_FI_SADevelopments for Saudi Arabia
FIAPSAD_ATCHMTAttachment details for Expenditure/Payment orderGLO_FIN_FI_SADevelopments for Saudi Arabia
FIARQAD_CRV_HDCash Receipt Voucher Header tableGLO_FIN_FI_QAPSFI Localization for Qatar Public Sector
SAFM_APD_PP_DOCUPayment Proposal - DocumentGLO_FM_SA_02Developments for Saudi Arabia Public Sector
SAFM_APD_PP_DOCUPayment Proposal - DocumentGLO_FM_SA_02Developments for Saudi Arabia Public Sector
FMEUFCERTINFOCertification Run InfoFMEUF_EExpenditure Certification
FMEUFFNSFinancing SourceFMEUF_EExpenditure Certification
FMEUFLNKFinancing Source and Operation LinkFMEUF_EExpenditure Certification
FMEUFOPHDefine Operation HeaderFMEUF_EExpenditure Certification
FMEUFPRELCONSPreliminarily Certified AmountsFMEUF_EExpenditure Certification
FMEUFRUNCertification Run ParameterFMEUF_EExpenditure Certification
FMEUFTIMFinancing Source Time SlicesFMEUF_EExpenditure Certification
FMEUF_PREL_FS_COObsolete!! To be removed!!FMEUF_EExpenditure Certification
FMCCAVCRESERVECCAVC aux table for reserved itemsFMCCAVC_EAktive Verf�gbarkeitskontrolle f�r Kassenbestand
FMCCBASIDXIndex table for structuresFMCCAVC_EAktive Verf�gbarkeitskontrolle f�r Kassenbestand
FMCCSRCIDXIndex table for sourcesFMCCAVC_EAktive Verf�gbarkeitskontrolle f�r Kassenbestand
FMFEE_HISTORYFee run history for interest calculationFMFG_FI_EValue Pack US Federal FI extensions
FMFEE_TYPESFee typesFMFG_FI_EValue Pack US Federal FI extensions
FMFG_PRIOR_RPTKFPrior Reported KeyfiguresFMFG_RPT_EUS Federal Government Reporting
FMRES_RECV_LISTList of all rescheduled receivablesFMFG_FI_EValue Pack US Federal FI extensions
T023BMinimum &maximum amount of interest penaltiesFMFG_PPA_EPrompt Payment Act
T023EInvoice line item handling rulesFMFG_PPA_EPrompt Payment Act
T023NMaximum amountFMFG_PPA_EPrompt Payment Act
/SAPF15/TAZV/SAPF15/F15
FMFGRCN_SAV_ITEMSaved reconciliation match item dataFMFG_RECON_EReconciliation Tool
PSBM_EVENTPS Budget Monitoring EventsPSM_BU_MONITOR_EPublic Sector Budget Monitor
TBKBCBank Chain from Corresponding BanksFMZEISPS: Payment program for payment requests - EU-specifics
TBKCBHouse Bank per CurrencyFMZEISPS: Payment program for payment requests - EU-specifics
TBKCRHouse Bank per Super Region and CurrencyFMZEISPS: Payment program for payment requests - EU-specifics
TBKLAMaximum Payment Amount for each House Bank (limit amount)FMZEISPS: Payment program for payment requests - EU-specifics
TBKPDDay difference betw. payment run and house bank valuationFMZEISPS: Payment program for payment requests - EU-specifics
PFM_12TCSSAmounts for Social Security certificate validationPFM_12FIObjects for FI module
PFM_12TFA03Year closing: financ.docs.data to pass to the new managementPFM_12FIObjects for FI module
PFM_12TFA04Year closing: docs.budg.classif.to pass to new managementPFM_12FIObjects for FI module
PFM_12TSLD_ML_FIFI: balances table por legal mapsPFM_12FIObjects for FI module
PFM_1TCDECONTROL OF EXPENDITURESPFM_1FIDevelopment class for FI
PFM_1TDUOData necessary to twelfths managementPFM_1FIDevelopment class for FI
PFM_1TMFCData for cash flow mapPFM_1DDPFM_1DD
PFM_1TPADControl table for twelfth anticipation requestPFM_1DDPFM_1DD
PFM_1TVTBTable for gross wages with payment by treasuryPFM_1DDPFM_1DD
PFM_1TVTDTable for gross wages discounts paid by treasuryPFM_1DDPFM_1DD
PFM_HRDOCSCoverages and commitments of HR and FI integrationPFM_01HRHR developments
PFM_TDPLC_FECHOPLC closingPFM_EA_PSObjects for EA-PS module
PFM_TDPLC_FUNDSPLC: credit release request data (funds view)PFM_EA_PSObjects for EA-PS module
PFM_TDPLC_FUND_NCRR: credit release request data (funds view) (CL)PFM_EA_PSObjects for EA-PS module
PFM_TDPLC_HDRPLC: credit release request data (header)PFM_EA_PSObjects for EA-PS module
PFM_TDPLC_POSPLC: credit release request data (item)PFM_EA_PSObjects for EA-PS module
PFM_TDPLC_POS_NCCRR: credit release request data (item) (CL)PFM_EA_PSObjects for EA-PS module
PFM_TDPLC_RP_DCCRR: credit release request data (item) (RP)PFM_EA_PSObjects for EA-PS module
PFM_TDTRANSF_HDRCredit transfer: credit transfer data (header)PFM_EA_PSObjects for EA-PS module
BURBCALCRULESCalculation Formulas for Revenues Increasing the BudgetFMBP_ENew Budgeting: generic part
FMCFBAPPISPS: Budget Closing Operations: Manual ApprovalFMCFFM: Year End Procedure
FMBKABSTFMKOFM: Reporting for German Local Authorities
FMCJ_BTRFMKOFM: Reporting for German Local Authorities
PSOBFIFI Position (Day-end Closing)FMKOFM: Reporting for German Local Authorities
PSOBFI_INIFMKOFM: Reporting for German Local Authorities
PSOBFMFM Positions Table of Day-end ClosingFMKOFM: Reporting for German Local Authorities
PSOBFM_INIFMKOFM: Reporting for German Local Authorities
PSOBKFIFMKOFM: Reporting for German Local Authorities
FMCJIS-PS: Documents in Cash Desk Subsidiary LedgerFMCJIS-PS: Cash Desk Subsidiary Ledger
FMFUNDTRANSYEARAdditional Documents for Funds Transfer to Diff. YearsFMFIIS-PS: FI Basics for Funds Management
FMPSOINTADDAdditional Data on Interest FormulaFMFIIS-PS: FI Basics for Funds Management
PAYOAPayment Order - Additional DataFMFI_EUIS-PS: Basics for Funds Management for EU
PSKW5Additional Data for Public-Law Dunning ProcedureFMKWIS-PS: Fiscal Cash Accounting
PSO37Payment Block to be Set AutomaticallyFMFIIS-PS: FI Basics for Funds Management
PSO40Rounding UnitsFMFIIS-PS: FI Basics for Funds Management
PSO53Define Petty Amount LimitsFMFIIS-PS: FI Basics for Funds Management
PSOKPFRecurring Request Document HeaderFMFIIS-PS: FI Basics for Funds Management
PSOSEGDDocument Segment: Recurring Request, CustomerFMFIIS-PS: FI Basics for Funds Management
PSOSEGKRecurring Request Document Segment, VendorsFMFIIS-PS: FI Basics for Funds Management
PSOSEGSRecurring Request Document Segment, G/L AccountsFMFIIS-PS: FI Basics for Funds Management
PSOWF1Variant-Dependent Data for Workflow Request (FMPSO)FMFIIS-PS: FI Basics for Funds Management
GMBDGTHEADERBudget Document HeaderGMBUDGETING_EGrants management (budgeting)
GMHBDGTHEADERBudget Header: Held DocumentsGMBUDGETING_EGrants management (budgeting)
GMGTSPONSORSponsor Master: Grant Type dependant attributesGMMASTERDATA_EGrants management (master data)
GMWFBUDGETGM Workflow Grant MasterGMMASTERDATA_EGrants management (master data)
GTR_NOTIFY_TRIGTrigger table for Grantor ERP->CRM NotificationGTR_INTEGRATION_E_1Grantor Management: Enhancement to integration topics
HCMFAB_ASSIGNMNTFab Fiori : Database Table for AssignmentsODATA_HCMFAB_MYTIMESHEETOData service for MyTimesheet App
HCMFABDE_D_PINFOESS Pens.Info.: Pension InformationHCMFAB_DE_MYPENSIONINFODE - ESS Pension Information
IBROSTMCFClarif. Cases from Broker ReportISCDBROKFS-CD: Broker Collections
IBROSTMHISCD: Broker Report - Header DataISCDBROKFS-CD: Broker Collections
IBROSTMPISCD: Broker Report - Item DataISCDBROKFS-CD: Broker Collections
IBROSTMSUMBroker Summary Postings - Restart InformationISCDBROKFS-CD: Broker Collections
TKKVTELE010AIns. Dunning: Telephone Collections: STATUS DeterminationISCDFUNFS-CD: Collections/Disbursements Functionality
TKKV_REPCL_TAMoney Laundering Law Reporting: Transactions Subj. to RptgISCDFUNFS-CD: Collections/Disbursements Functionality
VINTEGBALANCEDTrigger for Fully Cleared DocumentsVINTEGIntegration of Insurance Solution
VKKQUOTSQuotation Monitoring FS-CD Acceptance StatusISCDFUN_ENFS-CD: Collections/Disbursements Functionality
VVKKCFCSTELInsurance Dunning: Telephone CollectionsISCDFUNFS-CD: Collections/Disbursements Functionality
VVKKDEPOTDeposit Int. Calc. TableISCDFUNFS-CD: Collections/Disbursements Functionality
VVKKDRKODunning Printout:Header ItemsISCDFUNFS-CD: Collections/Disbursements Functionality
VVKKDRZEDunning Notice Output: Repetition ItemsISCDFUNFS-CD: Collections/Disbursements Functionality
VVKKFAPOSInvoicing Items in FS-CDISCDFUNFS-CD: Collections/Disbursements Functionality
VVKKFKODoc Header Posting Data InterfaceISCDFUNFS-CD: Collections/Disbursements Functionality
VVKKFKOTTable for FS-CD Test Data of Structure vkkkfkoISCDFUNFS-CD: Collections/Disbursements Functionality
VVKKMAKTExecuted Dunning ActivitiesISCDFUNFS-CD: Collections/Disbursements Functionality
VVKKMHISTContract-Related Dunning HistoryISCDFUNFS-CD: Collections/Disbursements Functionality
VVKKREPCLMoney Laundering Clarification WorklistISCDFUNFS-CD: Collections/Disbursements Functionality
VVKKREPCL_REPFS-CD: Money Laundering Law Reporting StateISCDFUNFS-CD: Collections/Disbursements Functionality
VVKKREPNPCoinsurance Reporting: Report Item OBSOLETEISCDFUNFS-CD: Collections/Disbursements Functionality
VVKKREPRPCoinsurance Reporting: Recording Item OBSOLETEISCDFUNFS-CD: Collections/Disbursements Functionality
VVKK_COINSHCoinsurance Shares Header TableISCDFUNFS-CD: Collections/Disbursements Functionality
VVKK_COINSPCoinsurance Shares Item TableISCDFUNFS-CD: Collections/Disbursements Functionality
ITAGCYACCDOCAgency Collections: Posted Document from Acct Maint.FSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYBNKTRTRIGGTrigger Table Bank Deposits for AgenciesFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYCFCash Desk CarryforwardFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYCFCash Desk CarryforwardFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYCLEARSUMItalian Agency Collections: Clearing Account TotalsFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYCOLLTRTransfer InformationFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYCOLLTRTransfer InformationFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYCOMMCLEARTriggerTab Commission to Subagent from Internal AgenciesFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYCONTDIFFContainer Differences in Case of Multiple Diffs per ItemFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYCONTPItems for a ContainerFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYDOCENHAdditional Document DataFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYDOCTRDocument TransferFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYDOCTRDocument TransferFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYINSCOMPSHAgency Collections: Shares to Be Transferred to InsuranceFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYPAYPayment InformationFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYPAYPayment InformationFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYSUBCOMMCLRTrigger Table for Clearing Statistical SubcommissionFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYSUBCOMMTRGTrigger Table for Posting and Transferring SubcommissionFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYTCTemporary CollectionsFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYTCBPAgency Collections: Temporary Collections with BPFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYTPCOMMReported Commission for Items in a ContainerFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
ITAGCYWDTable for Withdrawal InformationFSCDITAGCY_DDICFS-CD: Italian Agency Management - DDIC Objects
DIMAPARSCPOSIO: Change to Scheduling ItemsFSCDMAD_IOFS-CD: Insurance Object
VVSCCLINFOBill Scheduling: Clearing InformationFSCDPP_OBSOLETPayment Plan: Obsolete Objects
VVSCITEMBill Scheduling: Scheduling DocumentFSCDPP_REPPayment Plan: Repository
VVSCITEMLBill Scheduling: for General LedgerFSCDPP_REPPayment Plan: Repository
VVSCITEM_MANScheduling Items: Temp. Storage for Manual -> Auto ChangeFSCDPP_REPPayment Plan: Repository
VVSCLOCKAMTScheduling: Premium Lock Period Share Already TransferredFSCDPP_REPPayment Plan: Repository
VVSCPOSPayment Plan ItemFSCDPP_REPPayment Plan: Repository
VVSCRESPAYMENTBill Scheduling: Universal LifeFSCDPP_REPPayment Plan: Repository
ICLCLAIMBException Table Payment Amount AuthorizationsICL_BASISFS-CM: General Functionality
ICL_SCWCOMP_DTHWorkers Comp - Benefits Catalog (Death)ICL_WCOMPWorkers Compensation
ICL_SCWCOMP_SCHWorkers Comp - Benefits Catalog (Scheduled)ICL_WCOMPWorkers Compensation
ICSCLAIMBException Table Payment Amount AuthorizationsICL_BASISFS-CM: General Functionality
TICL110Amount Authorizations for Payments/ReservesICL_BASISFS-CM: General Functionality
TICL110_RESTYPAmount Authorizations Reserves (per Reserve Type)ICL_BASISFS-CM: General Functionality
/GSINS/BRBPWHTTax Details � Brazil Insurance/GSINS/BR_WHTFS-CM Brazil: Withholding Tax
/GSINS/INH_DUMMYDummy Table for External Deductions/GSINS/PENS_REUFS-CM: Pension System � Reuse Package
/GSINS/INH_EXTDEExternal Transfers (in HCM infotype 0011)/GSINS/PENS_REUFS-CM: Pension System � Reuse Package
/PM0/ABDACMClaim Information FS-PM/PM0/ABT_CMFS-PM Basis Integration: Claims
S414BIW1S414BIW1 * SSR DTF statisticsOI0_BWOil/BW Business Information Warehouse (extractors,..)
S414BIW1S414BIW1 * SSR DTF statisticsOI0_BWOil/BW Business Information Warehouse (extractors,..)
S414BIW2S414BIW2 * SSR DTF statisticsOI0_BWOil/BW Business Information Warehouse (extractors,..)
S414BIW2S414BIW2 * SSR DTF statisticsOI0_BWOil/BW Business Information Warehouse (extractors,..)
ISCHDOFCHRGTP_DI_TRIPHEADTP I_TRIPSCHEDOFCHARGESTPOIT_LAYTDEM_BACKENDBackend Package
ISCHDOFCHRGTP_DI_TRIPHEADTP I_TRIPSCHEDOFCHARGESTPOIT_LAYTDEM_BACKENDBackend Package
ITRIPHEADTP_DI_TRIPHEADTP I_TRIPHEADTPOIT_LAYTDEM_BACKENDBackend Package
ITRIPHEADTP_DI_TRIPHEADTP I_TRIPHEADTPOIT_LAYTDEM_BACKENDBackend Package
ITRIPITEMTP_DI_TRIPHEADTP I_TRIPITEMTPOIT_LAYTDEM_BACKENDBackend Package
OIJ08_TRIPCHRGTrip Charge DetailsOIT_LAYTDEM_BACKENDBackend Package
OIJ08_TRIPCHRGTrip Charge DetailsOIT_LAYTDEM_BACKENDBackend Package
TOIJ08_TRIPTYPETrip TypesOIT_LAYTDEM_BACKENDBackend Package
OIA08LIA Document: Item DataOIAEXG Exchanges
OIA10Exchange - Netting document itemOIA_FIEXG Exchanges (FI <financials> + LO <logistic>)
OIA12IMovement Based Netting document itemOIAEXG Exchanges
OIA12ICONDConditions of OIA12I itemsOIAEXG Exchanges
OIAFEFee history tableOIAEXG Exchanges
OIANFFee Condition RecordsOIAEXG Exchanges
OIC_KONVConditions (Procedure Data)OICMAP Marketing, Accounting and Pricing
OIC_OIANFFee Condition RecordsOICMAP Marketing, Accounting and Pricing
OIFBBP1Business partner role assignments (IS-Oil MRN)OIFMRN Marketing Retail Networks
OIRECCTYPSSR PC: Company code / credit card typesOIR_ESSR Card processing (IS-Oil Sevice Station Retailing)
OIREPBLSSR PC: Types per business locationOIR_ESSR Card processing (IS-Oil Sevice Station Retailing)
OIRESPCRSSR PC: Splitting criteriaOIR_ESSR Card processing (IS-Oil Sevice Station Retailing)
OIREUPLKXXXXSSR PC: Template for generated DTF tables (header)OIR_ESSR Card processing (IS-Oil Sevice Station Retailing)
OIRE_RECON_ADMAdministration data for the reconciliation filesOIR_ESSR Card processing (IS-Oil Sevice Station Retailing)
OIRE_RECON_AGGAggregated reconciliation dataOIR_ESSR Card processing (IS-Oil Sevice Station Retailing)
OIRE_RECON_DETDetailed reconciliation dataOIR_ESSR Card processing (IS-Oil Sevice Station Retailing)
OIRHCHSTRNSMNClearing House Transmission-Message log(IS-OIL, SSR)OIR_HSSR Interfaces/Internet/BAPIs (IS-Oil ServiceStationRetail.)
S414SSR DTF statisticsOIR_ESSR Card processing (IS-Oil Sevice Station Retailing)
S414SSR DTF statisticsOIR_ESSR Card processing (IS-Oil Sevice Station Retailing)
S414ES414 - Structural informationOIR_ESSR Card processing (IS-Oil Sevice Station Retailing)
S414ES414 - Structural informationOIR_ESSR Card processing (IS-Oil Sevice Station Retailing)
OIH01Excise Duty Rates TableOIHTDP Tariffs, Duties and Permits
OIH01AExcise Duty Rates TableOIHTDP Tariffs, Duties and Permits
OIH_TAX_REVExcise Duty Revaluation DocumentsOIHTDP Tariffs, Duties and Permits
OIJS435TSWEnhanced S435 LIS Table to hold TSW MoTOIJTSW Traders and Schedulers Workbench
OIJ_EL_TICKET_HUniversal ticket tableOIJ_ELTSW Trader's and Scheduler's Workbench - Execution Layer
S435Statistics: Material Movements for Batches / NOT USED ANYMOIJTSW Traders and Schedulers Workbench
ISRCENOMSCHED_DI_DEMANDNOMINATIONSCHEDULETP I_SOURCENOMINATIONSCHEDULETPOIJ09_SCHDASST_BACKENDScheduling Assistant : Backend
ISRCENOMSCHED_DI_DEMANDNOMINATIONSCHEDULETP I_SOURCENOMINATIONSCHEDULETPOIJ09_SCHDASST_BACKENDScheduling Assistant : Backend
OIJ09_SCHEDSRCScheduling OptionsOIJ09_SCHDASST_BACKENDScheduling Assistant : Backend
OIJ09_SCHEDSRCScheduling OptionsOIJ09_SCHDASST_BACKENDScheduling Assistant : Backend
/ACCGO/T_PF_TEMPTable to store Price FIxations Temporary Data/ACCGO/ACM_CNTRCTS_DBPackage for Contracts Database Layer
/ACCGO/T_CANCLTrading Contract Cancellations Information/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_CANCLTrading Contract Cancellations Information/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_CANC_CCCommodity Contract Cancellation Information/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_CANC_CCCommodity Contract Cancellation Information/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_CANC_PLCommodity Contract Cancellations Pricing Lot Information/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_CAS_AGHHeader details of Application group/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_CAS_CAHCA Application Document Header/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_CAS_CAHCA Application Document Header/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_GRP_HDRSettlement Group Header/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_GRP_HDRSettlement Group Header/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_GRP_HDRSettlement Group Header/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_GRP_HDRSettlement Group Header/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_GRP_HDRSettlement Group Header/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_GRP_HDRSettlement Group Header/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_KOMVKOMV table for displaying pricing in settlement/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_LN_FILLTable to maintain Central Filing Notification/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_PRC_DISDet. Price Info. of Pricing Lots for Shadow Document/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_PRC_DISDet. Price Info. of Pricing Lots for Shadow Document/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_PRC_DISDet. Price Info. of Pricing Lots for Shadow Document/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_PRC_DISDet. Price Info. of Pricing Lots for Shadow Document/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_PRC_DISDet. Price Info. of Pricing Lots for Shadow Document/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_PRC_DISDet. Price Info. of Pricing Lots for Shadow Document/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_PRC_DISDet. Price Info. of Pricing Lots for Shadow Document/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_PRC_DISDet. Price Info. of Pricing Lots for Shadow Document/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_PRC_DISDet. Price Info. of Pricing Lots for Shadow Document/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_QD_VALQ-Rep DPQS Value evaluation/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_QR_AP_NTable for Q-Rep Entries for DPQS Negotiate/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_QR_OPTQ - Rep Optionality data/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_STLAMTSDictionary Table for Settlement Amounts/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_STLAMTSDictionary Table for Settlement Amounts/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_STLAMTSDictionary Table for Settlement Amounts/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_STLCPRCSettlement calculated (PriceLot) Prices/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_STLDPQSSettlement Quality/DPQS item table/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_STLHEADSettlement header table/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_STLHEADSettlement header table/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_STLHEADSettlement header table/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_STLHEADSettlement header table/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_STLHEADSettlement header table/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_STLITEMSettlement Item Table/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_STL_OPTOptionality transactional data at settlement/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_STL_PREPrepayment table for settlement/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_WASH_HNon standard Washout ID header table/ACCGO/COMMONACCGO: Package for all DDIC and Common Objects
/ACCGO/T_BP_PRODAdditional Producer Information for BP/ACCGO/PPMG_MASTER_DATAACM Prepayment Package for Master Data
/ACCGO/T_ECO_GRPEconomic Group for Counterparty/ACCGO/PPMG_MASTER_DATAACM Prepayment Package for Master Data
/ACCGO/T_PYM_TRTrading Contract Payment Terms : OBSOLETE/ACCGO/PPMG_CCAKACM Prepayment Package for Contract
/ACCGO/T_FEE_ASGTransactional Fee Data/ACCGO/FEEACCGO: Package for Fee Objects
ACCGO_ND_DUMMYDummy Table for NetdryACCGO_NETDRY_CDSNet-dry CDS Views
ACM_DUMMY_KONVDDummy Table for Netdry Report: KONVD and VLOGP dataACCGO_NETDRY_CDSNet-dry CDS Views
ACCGO_CPE_TRMINPDummy Table for Fallback Class for CPE Term InputACCGO_ACM_CONTRACT Package for Contract CDS Views
/ACCGO/CDOTE_BUFTable to store PSMGUIDs for CDOTE orders created from MPWC/ACCGO/MASS_PRICINGMass Pricing
/ACCGO/CDOTE_BUFTable to store PSMGUIDs for CDOTE orders created from MPWC/ACCGO/MASS_PRICINGMass Pricing
/ACCGO/CDOTE_BUFTable to store PSMGUIDs for CDOTE orders created from MPWC/ACCGO/MASS_PRICINGMass Pricing
/ACCGO/T_RC_TRACReason Code Trace/ACCGO/CCAK_CRTNContract Creation
/ACCGO/T_SNPCANCDocument Snapshot : Contract Cancellation Data/ACCGO/COPRContract Output Processing
/ACCGO/T_SNPCANCDocument Snapshot : Contract Cancellation Data/ACCGO/COPRContract Output Processing
/ACCGO/T_SNPCANPDocument Snapshot : Contract Cancellation Pricing Data/ACCGO/COPRContract Output Processing
/ACCGO/T_SNPHD2Contract Business Data/ACCGO/COPRContract Output Processing
/ACCGO/T_BRDIFFSTrue-up differences for Settlement Documents/ACCGO/BR_COMMONACCGO: Brazil Comon Objects
/ACCGO/T_BRDIFFSTrue-up differences for Settlement Documents/ACCGO/BR_COMMONACCGO: Brazil Comon Objects
/ACCGO/T_CNDMAPABD to Invoice condition type mapping Table/ACCGO/CAKSTLACCGO: Package for Contract Settlement
/ACCGO/T_CNDMAPABD to Invoice condition type mapping Table/ACCGO/CAKSTLACCGO: Package for Contract Settlement
T7PIQSINGLEFEESDefine Attributes for Individual FeesPMIQ_IAPStudent Lifecycle Management: Implementation Accelarator
TCMAC06DDerivation of ISR Scenario Related DataCMAC_ECampus Management: Student Account
HRP1890DB Table for Infotype 1890PMIQ_NLStudent Lifecycle Management - Netherlands
HRP1890DB Table for Infotype 1890PMIQ_NLStudent Lifecycle Management - Netherlands
HRP1890DB Table for Infotype 1890PMIQ_NLStudent Lifecycle Management - Netherlands
HRP1890DB Table for Infotype 1890PMIQ_NLStudent Lifecycle Management - Netherlands
HRP1890DB Table for Infotype 1890PMIQ_NLStudent Lifecycle Management - Netherlands
HRT1894Table Part Infotype 1894PMIQ_NLStudent Lifecycle Management - Netherlands
HRT1894Table Part Infotype 1894PMIQ_NLStudent Lifecycle Management - Netherlands
HRT1894Table Part Infotype 1894PMIQ_NLStudent Lifecycle Management - Netherlands
HRT1894Table Part Infotype 1894PMIQ_NLStudent Lifecycle Management - Netherlands
HRT1894Table Part Infotype 1894PMIQ_NLStudent Lifecycle Management - Netherlands
HRT1894Table Part Infotype 1894PMIQ_NLStudent Lifecycle Management - Netherlands
PIQDB_US_BPEXPSEVIS: Student expense dataPMIQ_USCampus Management USA
PIQDB_US_BPFUNDSEVIS: Student funds dataPMIQ_USCampus Management USA
PMIQ_US_STORDATA1098T: Store Student�s form dataPMIQ_USCampus Management USA
FMCA_DM_EA_EXTEnforcement Action Header ExtensionFMCA_DM_REPDebt Management : Replication from CRM
DFMCA_DM_DUNACTDM: Enforcement Action List from Dunning Activity RunFMCA_DM_MAINPSCD: Public Sector Debt Management Main Package
DFMCA_DM_DUNEADM: Enforcement Action List from DunningFMCA_DM_MAINPSCD: Public Sector Debt Management Main Package
DPSOB_BP_ACCData for Contract Object for Each Partner & Cont. Acct Cat.FMCA_PSOBPSCD: Contract Object
DFKKTHI_HIST2Reversal: Historical Entries DFKKTHI (w/o Tax Posting)FKKTHPConvergent Billing
DFKKTHI_SUMAggregated Transfer Records for InvoicingFKKTHPConvergent Billing
SND_AO_ISU_HSAF-T AO: ISU HeaderID-SAFT-AO-ISUSAF-T Angola IS-U
/SAPCE/IURU_BCODBenefits: New Account Assigment for Benefit Posting/SAPCE/IU_REUIS-U localization Reused Objects
/SAPCE/IURU_BPOSBenefits: Posting Details for Benefits/SAPCE/IU_REUIS-U localization Reused Objects
/SAPCE/IUUA_ESUBSubsidy: Subsidies Eligibility/SAPCE/IU_REUIS-U localization Reused Objects
/SAPCE/IUUA_SBENSocial Benefits: Store Amounts of Soc.Ben. per Periods/SAPCE/IU_REUIS-U localization Reused Objects
/SAPCE/IUUA_SCODSubsidies: New Account Assigment for Subsidy Posting/SAPCE/IU_REUIS-U localization Reused Objects
/SAPCE/IUUA_SPOSSubsidy: Posting Details for Subsidies/SAPCE/IU_REUIS-U localization Reused Objects
/SAPCE/IU_DPRQ5Parameters of BB-Plan for Industrial Customers(BB-Proc=5)/SAPCE/IU_REUIS-U localization Reused Objects
/SAPCE/PL_BBPICPoland: Default BB-Plan for Industrial Customers BBP2/SAPCE/IUPL_BBIISU Localization for Poland: Budget billing and Invoicing
ISULOSSVERSIONI_UTILITIESNEWFRAUDTP I_UTILITIESFRAUDVERSIONTPISU_GS_BR_FRAUDIS-U Brazil - Fraud localization
TISU_EL_VERS_BRIS-U-BR Engy.Loss: Table VersionISU_GS_BR_FRAUDIS-U Brazil - Fraud localization
TISU_INST_FAC_BRIS-U-BR Bill.Sim: Installation FactsISU_GS_BR_SIMULATIONIS-U Brazil - Simulation localization
TISU_SIM_DOCI_BRIS-U-BR Bill.Sim: Persist Table ItemISU_GS_BR_SIMULATIONIS-U Brazil - Simulation localization
ECONCPOSTPosting Details for ConcessionECONCESSIONIS-U : Concession
TE014_COMP_INDComponents for LPC, PPI, InterestISU_GS_INIS-U India - Objects for IS-U
TE014_TOL_INDLPC/PPI limitsISU_GS_INIS-U India - Objects for IS-U
TECONTYPConcession TypeECONCESSIONIS-U : Concession
ECONDIPARAMParameter Definition of Conditional Application StructureEE20IS-U: Billing
EKDIRate FactsEE20IS-U: Billing
ETTAFRate Cat.FactsEE20IS-U: Billing
ETTIFInstln FactsEE20IS-U: Billing
ETTIFInstln FactsEE20IS-U: Billing
ETTIFBInstallation Facts (Reference Values)EE20IS-U: Billing
ETTIFBInstallation Facts (Reference Values)EE20IS-U: Billing
ETTIFNInstallation Facts (Normal)EE20IS-U: Billing
TEPREPAYCustomizing Settings for Prepayment MeterEE20IS-U: Billing
ISUD_PS_PRODFACTBilling Fact Value for UPIL ProductISU_PS_APIIS-U: Utilities Product Simplification API
ESIMCHARSimulation CharacteristicsEE20_PPProduct Proposal
EMKT_ESTM_CONSMarketing: Extrapolated Consumption for Each ContractEE_CRM_MKT_BIWBW Extractors fur IS-U/CRM Marketing
EMKT_ESTM_CONSMarketing: Extrapolated Consumption for Each ContractEE_CRM_MKT_BIWBW Extractors fur IS-U/CRM Marketing
EMKT_ESTM_CONS_PMarketing: Extrapolation Index for Mass ActivityEE_CRM_MKT_BIWBW Extractors fur IS-U/CRM Marketing
EMKT_ESTM_CONS_PMarketing: Extrapolation Index for Mass ActivityEE_CRM_MKT_BIWBW Extractors fur IS-U/CRM Marketing
TEAMI_EM_EVTATTRIS-U Event Management Attributes for AMI EventsEE_AMI_EM_COREISU Event Processing Core
EPROFHEADProfile Header DataEE_EDM_PROProfile Management
EPROFHEAD_TMPHeader Data of Temporary ProfileEE_EDM_PROProfile Management
IUEEDPPLOTATHEADDistribution Lot HeaderEE_DEREG_INVPayment Management in a Deregulated Environment
TINV_INV_DOCBilling Doc. DataEE_INVOICE_RECEIPTBill Receipt Checks
TINV_INV_LINE_APayment Advice LineEE_INVOICE_RECEIPTBill Receipt Checks
TINV_INV_LINE_BBill Line with Posting InformationEE_INVOICE_RECEIPTBill Receipt Checks
TINV_INV_LINE_IBill Line Item with Information (Not Relevant to Posting)EE_INVOICE_RECEIPTBill Receipt Checks
TINV_LINEB_SHORTExtract of Bill Receipt (Evaluation System): Bill LinesEE_DEREG_INVPayment Management in a Deregulated Environment
TINV_TRANSF_HSTReversal: Historical TINV_INV_TRANSF EntriesEE_DEREG_INVPayment Management in a Deregulated Environment
DEABPTable: Customer Change Header Data for BB AmountsEE25IS-U: Budget Billing Amounts
EABPBudget Billing PlanEE25IS-U: Budget Billing Amounts
EBBPTEMPTemporary Budget Billing DataEE25IS-U: Budget Billing Amounts
EJVLYearly Advance PaymentEE25IS-U: Budget Billing Amounts
EKLPCINVHistory of Charges for Installment Plan Items (LPC in USA)EE21IS-U: Invoicing
TE001RRules for Bill RoundingEE21IS-U: Invoicing
TE211BB: Rounding ParameterEE25IS-U: Budget Billing Amounts
TE501Control of bill due dateEE21IS-U: Invoicing
TE504Rounding Limits for Rounding BalanceEE21IS-U: Invoicing
TE557Minimum Charge/Amount Limit for BBEE25IS-U: Budget Billing Amounts
TE558Amount/Process Limits for Pay.Scheme Adjustment in InvoicingEE25IS-U: Budget Billing Amounts
TE560Percentage Limits for Manual Payment Scheme ChangesEE25IS-U: Budget Billing Amounts
TE647Dynamic Determination of BB CycleEE25IS-U: Budget Billing Amounts
TEPYPMContract history for generating payment scheduleEE25IS-U: Budget Billing Amounts
TEPYPM_TEMPLATETemplates for contract history, payment plan generationEE25IS-U: Budget Billing Amounts
EWAOBJH_AAT_HISTHistory and Valution of WBCs for Service Freq. ServiceEEWAIS-U: Waste Management
EWA_CCOC_ASS_EQCO Assignment and VehicleEEWA_CCOCIS-U: Waste Disposal Industry Controlling
EWA_CCOC_ASS_IUPAssign CO Data for WD Item and SD ItemEEWA_CCOCIS-U: Waste Disposal Industry Controlling
EWA_CCOC_ASS_IWPAssign CO Data WD Item and Waste/Waste Disposal FacilityEEWA_CCOCIS-U: Waste Disposal Industry Controlling
EWA_CCOC_ASS_REAllocate CO and Container (Rent)EEWA_CCOCIS-U: Waste Disposal Industry Controlling
EWA_CCOC_ASS_RSAssign CO Data to ResourcesEEWA_CCOCIS-U: Waste Disposal Industry Controlling
EWA_CCOC_ASS_WPCO Assignment to Waste Disposal FacilityEEWA_CCOCIS-U: Waste Disposal Industry Controlling
EWA_CCOC_ASS_WPCAllocation of CO Data for Weighing Transaction (Waste)EEWA_CCOCIS-U: Waste Disposal Industry Controlling
EWA_ORDER_HD_COHeader Table for Waste Disposal Order (CO Data)EEWA_CCOCIS-U: Waste Disposal Industry Controlling
EWA_ORDER_OBJ_COItem Table in Waste Disposal Order (CO Data)EEWA_CCOCIS-U: Waste Disposal Industry Controlling
EWA_ORDER_WGH_COWeighing Data Table for Waste Disposal Order (CO Data)EEWA_CCOCIS-U: Waste Disposal Industry Controlling
EWA_WA_WPROC_COWeighing Transaction (CO Data)EEWA_CCOCIS-U: Waste Disposal Industry Controlling
CTE_C_DEVIAT_CURDeviating currency handlingCTE_FND_IMPConcur T&E Integration: Central services like error handling
CTE_D_PAYMENTTable for Payment InformationCTE_FND_POST_IMPCentral Posting Objects
CTE_D_FIN_PAYPayment Information for Line Item of Financial DocumentCTE_FIN_POST_IMPConcur T&E Integration: FIN Posting related services
/PRA/ACCT_DOCAccounting document (All account types)/PRA/ACCOUNTING_DOCUMENTAccounting document
/PRA/ACCT_MDOCAccount document(JE) details for a Manual/PRA/ACCOUNTING_DOCUMENTAccounting document
/PRA/ACCT_RJDOCAccount document(JE) details for a Reject/PRA/ACCOUNTING_DOCUMENTAccounting document
/PRA/ACC_ANLYSTemporary table for storing analysis report/PRA/ACCOUNTING_DOCUMENTAccounting document
/PRA/ADV_TRANSAd valorem Transactions/PRA/AD_VALOREMAd valorem
/PRA/CI_ACC_DOCAccounting Document for Incoming Check (Temporary hold)/PRA/CHECK_INPUT_2.0Check input remodeled from Razorsih,new DB,BO, enhancements
/PRA/CI_HEADERIncoming Check Header Information/PRA/CHECK_INPUT_2.0Check input remodeled from Razorsih,new DB,BO, enhancements
/PRA/CI_HEADERIncoming Check Header Information/PRA/CHECK_INPUT_2.0Check input remodeled from Razorsih,new DB,BO, enhancements
/PRA/CV_VLACCDOCTemporary Accounting document for Comparison utility/PRA/REVENUE_DISTRIBUTIONRevenue distribution
/PRA/C_PP_TH_SPPayment Processing - Threshold Driven Special Handling Codes/PRA/PAYMENT_PROCESSINGPayment Processing
/PRA/FPY_PAY_SUMONRR-2014 - Payable Summary (PPN)/PRA/ONRR_2014ONRR-2014
/PRA/FP_FIN_RCONONRR-2014 - Financial Reconciliation Report Data/PRA/ONRR_2014ONRR-2014
/PRA/FP_HLD_ITMONRR-2014 - Held Items/PRA/ONRR_2014ONRR-2014
/PRA/FP_HST_CMP1ONRR-2014 - History Compare Table (Federal)/PRA/ONRR_2014ONRR-2014
/PRA/FP_HST_CMP2ONRR-2014 - History Compare Table (Indian)/PRA/ONRR_2014ONRR-2014
/PRA/FP_HST_REVONRR-2014 - Report Detail History (Basis of Reversal)/PRA/ONRR_2014ONRR-2014
/PRA/FP_OOSONRR-2014 - Out-Of-Statute PRA Details/PRA/ONRR_2014ONRR-2014
/PRA/FP_OOS_HSTONRR-2014 - Out-Of-Statute PRA Detail History/PRA/ONRR_2014ONRR-2014
/PRA/FP_PAY_ADDONRR-2014 - Payable Summary - Additional Info/PRA/ONRR_2014ONRR-2014
/PRA/FP_PAY_SUMONRR-2014 - Payable Summary/PRA/ONRR_2014ONRR-2014
/PRA/FP_PRDTONRR-2014 - PRA Details/PRA/ONRR_2014ONRR-2014
/PRA/FP_PRDTAONRR-2014 - PRA Details (Allocated)/PRA/ONRR_2014ONRR-2014
/PRA/FP_PRDTAHSTONRR-2014 - PRA Details (Allocated) History/PRA/ONRR_2014ONRR-2014
/PRA/FP_PRDT_HSTONRR-2014 - PRA Details (History)/PRA/ONRR_2014ONRR-2014
/PRA/FP_RCP_DTONRR-2014 - Recoupment Detail/PRA/ONRR_2014ONRR-2014
/PRA/FP_RCP_HDONRR-2014 - Recoupment Header/PRA/ONRR_2014ONRR-2014
/PRA/FP_RPDTONRR-2014 - Report Details/PRA/ONRR_2014ONRR-2014
/PRA/FP_RPDT_HSTONRR-2014 - Report Detail History/PRA/ONRR_2014ONRR-2014
/PRA/OWN_FT_REPFunds transfer report data/PRA/OWNERSHIPOwnership Main package
/PRA/OW_FT_RP_XIFunds transfer report data for XI/PRA/OWNERSHIPOwnership Main package
/PRA/PP_ACCT_DOCPP Temporary Accounting Doc table for Journalize step/PRA/PAYMENT_PROCESSINGPayment Processing
/PRA/PP_PAY_ADDPayment Processing - Payable Summary - Additional Info/PRA/PAYMENT_PROCESSINGPayment Processing
/PRA/PP_PAY_ADJPayment Processing - Payable Summary Adjustments/PRA/PAYMENT_PROCESSINGPayment Processing
/PRA/PP_PAY_OWNPayment Processing - Payable Summary (Owner Level)/PRA/PAYMENT_PROCESSINGPayment Processing
/PRA/PP_PAY_SUMPayment Processing - Payable Summary/PRA/PAYMENT_PROCESSINGPayment Processing
/PRA/PP_SUS_ADDPayment Processing - Suspense Summary - Additional Info/PRA/PAYMENT_PROCESSINGPayment Processing
/PRA/PP_SUS_ADJPayment Processing - Suspense Summary Adjustments/PRA/PAYMENT_PROCESSINGPayment Processing
/PRA/PP_SUS_OWNPayment Processing - Suspense Summary (Owner Level)/PRA/PAYMENT_PROCESSINGPayment Processing
/PRA/PP_SUS_SUMPayment Processing - Suspense Summary/PRA/PAYMENT_PROCESSINGPayment Processing
/PRA/QUE_PP_SUMDatabase to store Queue monitor Owner summarized data/PRA/PAYMENT_PROCESSINGPayment Processing
/PRA/RD_CRHCombined Run Header Table/PRA/REVENUE_DISTRIBUTIONRevenue distribution
/PRA/TEMP_OWN_TPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/TEMP_PP_OWNPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/T_OWN_FT_REFunds transfer report data for simulation/PRA/OWNERSHIPOwnership Main package
/PRA/T_PP_OWN_TPayment Processing - Owner Info/PRA/TEMPRoadmap Build-Out Temporary Package
/PRA/VL_ACC_DOCTemporary Accounting document (All account types)/PRA/REVENUE_DISTRIBUTIONRevenue distribution
/PRA/VL_DA_LOGFRDual Accounting audit log Formula HDR/PRA/VALUATIONValuation
/PRA/VL_DA_LOGFRDual Accounting audit log Formula HDR/PRA/VALUATIONValuation
/PRA/VL_DA_LOGFRDual Accounting audit log Formula HDR/PRA/VALUATIONValuation
/PRA/VL_DA_LOGFRDual Accounting audit log Formula HDR/PRA/VALUATIONValuation
/PRA/VL_DA_LOGMKDual Accounting audit log Formula MKT/PRA/VALUATIONValuation
/PRA/WH_OWN_GRPTable for Saving Owner Group Details/PRA/WH_PROCESSINGWithholding Processing
/PRA/WH_PAY_SUMWithholding Payable summary/PRA/WH_PROCESSINGWithholding Processing
/PRA/ESCH_ADJProc 2.0 - Escheat - Suspense Summary Adjustments/PRA/PROCESS_2.0Process 2.0
/PRA/ESCH_DTLProc 2.0 - Escheat - Owner Details/PRA/PROCESS_2.0Process 2.0
/PRA/ESCH_DTLHProc 2.0 - Escheat - Owner Details History/PRA/PROCESS_2.0Process 2.0
/PRA/ESCR_ADJProc 2.0 - WY Escrow - Suspense Summary Adjustments/PRA/PROCESS_2.0Process 2.0
/PRA/ESCR_ADJ_ARAR Escrow - Suspense Summary Adjustments/PRA/PROCESS_2.0Process 2.0
/PRA/ESCR_DTLProc 2.0 - WY Escrow - Owner Details/PRA/PROCESS_2.0Process 2.0
/PRA/ESCR_DTL_ARAR Escrow - Owner Details/PRA/PROCESS_2.0Process 2.0
/PRA/P2_ACCT_DOCAccounting document (All account types)/PRA/PROCESS_2.0Process 2.0
/PRA/XTRCT_ROYNew Royalty Engine - Royalty Extraction - Main/PRA/TPTax Payable
OIUX1_ARCH_TAXHTax transaction header for reportingOIUPRA Production and Revenue Accounting (Upstream Business)
OIUX2_PUID_TAXHTax transaction header for reportingOIUPRA Production and Revenue Accounting (Upstream Business)
OIU_DO_DODivision of Interest OwnershipOIUPRA Production and Revenue Accounting (Upstream Business)
OIU_DO_DO_HSSDivision of Interest Ownership History SnapshotOIUPRA Production and Revenue Accounting (Upstream Business)
OIU_DO_DO_WKDivision of Interest Ownership WorktableOIUPRA Production and Revenue Accounting (Upstream Business)
OIU_RV_CMCDContract Marketing Cost DetailOIUPRA Production and Revenue Accounting (Upstream Business)
OIU_RV_DMCHProperty/DOI Marketing Cost HeaderOIUPRA Production and Revenue Accounting (Upstream Business)
OIU_RV_GRVDGravity Scale Adjustment DetailOIUPRA Production and Revenue Accounting (Upstream Business)
OIU_RV_PBDPrice Bulletin Posting TableOIUPRA Production and Revenue Accounting (Upstream Business)
OIUGR_OOSHSTGen Roy 2.0 - Out-of-Statute HistoryOIU_GRGeneric Royalty SLA
OIUGR_OOSTXNGen Roy 2.0 - Out-of-Statute TransactionsOIU_GRGeneric Royalty SLA
OIUGR_PRDTGen Rep - PRA Detail TransactionOIU_GRGeneric Royalty SLA
OIUGR_PRDTAGen Rep - Royalty Transaction (Allocated)OIU_GRGeneric Royalty SLA
OIUGR_ROYHSTGen Rep - Royalty Transaction HistoryOIU_GRGeneric Royalty SLA
OIUGR_ROYHSTAGen Rep - Royalty Transaction History (Allocated)OIU_GRGeneric Royalty SLA
OIUGR_ROYSTGGen Rep - Royalty Transaction (Staging)OIU_GRGeneric Royalty SLA
OIUGR_ROYTXNGen Rep - Royalty TransactionOIU_GRGeneric Royalty SLA
OIUGR_ROYTXNAGen Rep - Royalty Transaction (Allocated)OIU_GRGeneric Royalty SLA
OIUGR_RPDTGen Rep - Report Detail TransactionOIU_GRGeneric Royalty SLA
OIUX1_ADJ_TAXDCTax adjustments detail for reportingOIU_X1PRA Tax Reporting - Tax Reporting Framework
OIUX1_PUID_TAXHTax transaction header for reportingOIU_X1PRA Tax Reporting - Tax Reporting Framework
OIUX1_RPT_TAXHTax transaction header for reportingOIU_X1PRA Tax Reporting - Tax Reporting Framework
OIUX1_TRN_TAXDCTax transaction detail for reportingOIU_X1PRA Tax Reporting - Tax Reporting Framework
OIUX1_TRN_TAXDLTax transaction detail for reportingOIU_X1PRA Tax Reporting - Tax Reporting Framework
OIURV03_FRMHDRValuation Transaction Level 3 - FormulaOIU_RV03MP to Well Completion Split Out
OIURV03_FRMHDRValuation Transaction Level 3 - FormulaOIU_RV03MP to Well Completion Split Out
OIURV03_FRMHDRValuation Transaction Level 3 - FormulaOIU_RV03MP to Well Completion Split Out
OIURV03_FRMHDRValuation Transaction Level 3 - FormulaOIU_RV03MP to Well Completion Split Out
OIURV03_FRMTAXValuation Transactions Level 3 - Formula Tax DetailOIU_RV03MP to Well Completion Split Out
OIURV03_TAXDTLValuation Tax Master DetailOIU_RV03MP to Well Completion Split Out
OIURV03_TAXEMPValuation Tax Exempt DetailOIU_RV03MP to Well Completion Split Out
OIURV03_TAXHDRValuation Tax HeaderOIU_RV03MP to Well Completion Split Out
OIURV03_TAXMKTValuation Tax Marketing DetailOIU_RV03MP to Well Completion Split Out
OIUOW_DORHDO Owner Request HistoryOIU_RVOWPRA Ownership (Revenue)
OIUOW_DTDDOI Transfer Change DetailOIU_RVOWPRA Ownership (Revenue)
OIUOW_PPOwnership Production PaymentOIU_RVOWPRA Ownership (Revenue)
OIURV_DOC_FRMHDRValuation Transaction Level 3 - FormulaOIU_RVDCPRA Valuation (Document Concept)
OIURV_DOC_FRMHDRValuation Transaction Level 3 - FormulaOIU_RVDCPRA Valuation (Document Concept)
OIURV_DOC_FRMHDRValuation Transaction Level 3 - FormulaOIU_RVDCPRA Valuation (Document Concept)
OIURV_DOC_FRMHDRValuation Transaction Level 3 - FormulaOIU_RVDCPRA Valuation (Document Concept)
OIURV_DOC_FRMMKTValuation Transactions Level 3 - Marketing DetailOIU_RVDCPRA Valuation (Document Concept)
OIURV_DOC_FRMTAXValuation Transactions Level 3 - Formula Tax DetailOIU_RVDCPRA Valuation (Document Concept)
OIURV_DOC_RUNTKTValuation Transaction - Run TicketOIU_RVDCPRA Valuation (Document Concept)
OIURV_DOC_RUNTKTValuation Transaction - Run TicketOIU_RVDCPRA Valuation (Document Concept)
OIURV_DOC_TAXDTLValuation Tax Master DetailOIU_RVDCPRA Valuation (Document Concept)
OIURV_DOC_TAXEMPValuation Tax Exempt DetailOIU_RVDCPRA Valuation (Document Concept)
OIURV_DOC_TAXHDRValuation Tax HeaderOIU_RVDCPRA Valuation (Document Concept)
OIURV_DOC_TAXMKTValuation Tax Marketing DetailOIU_RVDCPRA Valuation (Document Concept)
OIURV_SSTDSettlement statement detailOIU_RVDCPRA Valuation (Document Concept)
OIURV_SSTD_MKTSettlement statement detailOIU_RVDCPRA Valuation (Document Concept)
OIURV_SSTD_TAXSettlement statement detailOIU_RVDCPRA Valuation (Document Concept)
OIURV_TCDTax calculation dataOIU_RVDCPRA Valuation (Document Concept)
OIUVL_GASDTL_CURGas statement DetailOIU_RVVAPRA Valuation (Revenue)
OIUVL_GASDTL_CURGas statement DetailOIU_RVVAPRA Valuation (Revenue)
OIUVL_GASDTL_HSTGas statement DetailOIU_RVVAPRA Valuation (Revenue)
OIUVL_GASDTL_HSTGas statement DetailOIU_RVVAPRA Valuation (Revenue)
OIUVL_GASRPTDGas statement report detailOIU_RVVAPRA Valuation (Revenue)
OIUVL_GASRPTHGas statement report headerOIU_RVVAPRA Valuation (Revenue)
OIUVL_GASTAX_CURGas Statement Tax MarketingOIU_RVVAPRA Valuation (Revenue)
OIUVL_GASTAX_CURGas Statement Tax MarketingOIU_RVVAPRA Valuation (Revenue)
OIUVL_GASTAX_HSTGas Statement Tax MarketingOIU_RVVAPRA Valuation (Revenue)
OIUVL_GASTAX_HSTGas Statement Tax MarketingOIU_RVVAPRA Valuation (Revenue)
OIUVL_OILRPTDOil statement report detailOIU_RVVAPRA Valuation (Revenue)
OIUVL_OILRPTHOil statement report headerOIU_RVVAPRA Valuation (Revenue)
OIUVL_OILTAX_CUROil Run Statement Tax MarketingOIU_RVVAPRA Valuation (Revenue)
OIUVL_OILTAX_CUROil Run Statement Tax MarketingOIU_RVVAPRA Valuation (Revenue)
OIUVL_OILTAX_HSTOil Run Statement Tax MarketingOIU_RVVAPRA Valuation (Revenue)
OIUVL_OILTAX_HSTOil Run Statement Tax MarketingOIU_RVVAPRA Valuation (Revenue)
OIUVL_OILTKT_CUROil Ticket DetailOIU_RVVAPRA Valuation (Revenue)
OIUVL_OILTKT_CUROil Ticket DetailOIU_RVVAPRA Valuation (Revenue)
OIUVL_OILTKT_HSTOil Ticket CurrentOIU_RVVAPRA Valuation (Revenue)
OIUVL_OILTKT_HSTOil Ticket CurrentOIU_RVVAPRA Valuation (Revenue)
OIUVL_SCAUDITSettlement statement batchOIU_RVVAPRA Valuation (Revenue)
OIUVL_SSTHSettlement statement headerOIU_RVVAPRA Valuation (Revenue)
GLE_TECS_ESCL_CECS Escalation RuleAC_INT_ECS_PER_ACPECS: Automatic Correction System (Persistence Layer)
GLE_ECS_ITEMECS: Error Correction ItemsAC_INT_ECS_PER_APPLECS: Persistence Layer
GLE_FI_ITEM_MODFECS: Modified FI Line Items (Header/Item/Currency Data)AC_INT_ECS_PER_APPLECS: Persistence Layer
GLE_FI_ITEM_MODFECS: Modified FI Line Items (Header/Item/Currency Data)AC_INT_ECS_PER_APPLECS: Persistence Layer
GLE_FI_ITEM_ORIGECS: Original FI Line Items (Header/Line Item/Crcy Actg I/F)AC_INT_ECS_PER_APPLECS: Persistence Layer
GLE_FI_ITEM_ORIGECS: Original FI Line Items (Header/Line Item/Crcy Actg I/F)AC_INT_ECS_PER_APPLECS: Persistence Layer
ARO_CEP_HDRCost Estimation Plan HeaderARO_CEPCost Estimation Plan Handling
ARO_CEP_ITCost Estimation Plan ItemsARO_CEPCost Estimation Plan Handling
ARO_CEP_IT_APObligation Type Specific Cost Estimation Plan ItemsARO_CEPCost Estimation Plan Handling
ARO_HDRBasic ARO Data (General)ARO_GENERALGeneral Obligation Handling, UI, Services
ARO_HDR_APAccounting Principle Specific Header InformationARO_GENERALGeneral Obligation Handling, UI, Services
ARO_PERIOD_ACCRARO Periodic AccrualsARO_NEW_ACCOUNTINGARO New Intelligent Accounting
ARO_TA_APAccounting principle specific amounts per processARO_GENERALGeneral Obligation Handling, UI, Services
ARO_TA_CALCCalculation steps at cost estimation levelARO_GENERALGeneral Obligation Handling, UI, Services
ARO_TA_CFAccounting principle specific data at ARO transaction levelARO_GENERALGeneral Obligation Handling, UI, Services
ARO_TA_LAYAcc. principle specific data at cost estimation layer levelARO_GENERALGeneral Obligation Handling, UI, Services
ARO_TA_PLANSettlement Plan at ARO transaction levelARO_GENERALGeneral Obligation Handling, UI, Services
ARO_TA_SCALSimulated calculation steps at cost estimation levelARO_GENERALGeneral Obligation Handling, UI, Services
ARO_TA_SCFSimulated cash flow data at ARO transaction levelARO_GENERALGeneral Obligation Handling, UI, Services
ARO_TA_SLAYSimulated data at cost estimation layer levelARO_GENERALGeneral Obligation Handling, UI, Services
/CPD/FC_PRICINGPricing Master data/CPD/PFP_CUSTto be translated
/CPD/AVR_HCS_ERPHierarchical Cost status: ERP scenario/CPD/AVR_UTILUtility Package
/CPD/AVR_PRG_DATBuffer Table for Progress Analysis Data/CPD/AVR_UTILUtility Package
/CPD/AVR_PRG_DATBuffer Table for Progress Analysis Data/CPD/AVR_UTILUtility Package
/CPD/AVR_PRG_DATBuffer Table for Progress Analysis Data/CPD/AVR_UTILUtility Package
/CPD/AVR_PRG_DATBuffer Table for Progress Analysis Data/CPD/AVR_UTILUtility Package
/CPD/AVR_PRG_DATBuffer Table for Progress Analysis Data/CPD/AVR_UTILUtility Package
/CPD/AVR_PRG_DATBuffer Table for Progress Analysis Data/CPD/AVR_UTILUtility Package
/CPD/AVR_PR_DATBuffer Table for Progress Analysis Data/CPD/AVR_UTILUtility Package
/CPD/AVR_PR_DATBuffer Table for Progress Analysis Data/CPD/AVR_UTILUtility Package
/CPD/AVR_PR_DATBuffer Table for Progress Analysis Data/CPD/AVR_UTILUtility Package
/CPD/AVR_PR_DATBuffer Table for Progress Analysis Data/CPD/AVR_UTILUtility Package
/CPD/AVR_PR_DATBuffer Table for Progress Analysis Data/CPD/AVR_UTILUtility Package
/CPD/AVR_PR_DATBuffer Table for Progress Analysis Data/CPD/AVR_UTILUtility Package
/CPD/PWSC_MP_ALTtable for mapping between Master project type and alert ID/CPD/PWS_WS_CUSTWorkspace Customizing Objects
/CPD/PWS_AGG_MPMaster Project Overall Aggregation Data/CPD/PWS_WS_UTILWorkspace Utilities
CPD_WS_KPIMaster Project KPIODATA_PWSOData Package for Project Workspace
START_A_DATA_VARTable to store Data VarianceFRM_S4C_DBS4C Package for DDIC objects
START_A_PR_HDRTable for storing ProcessFRM_S4C_DBS4C Package for DDIC objects
START_A_PR_STEPSA table for saving test stepsFRM_S4C_DBS4C Package for DDIC objects
START_S_DATA_VARS table for Data VariantsFRM_S4C_DBS4C Package for DDIC objects
START_S_PR_HDRS Table for Process dataFRM_S4C_DBS4C Package for DDIC objects
START_S_PR_STEPSS Table for START test stepsFRM_S4C_DBS4C Package for DDIC objects
START_TP_VARSGlobal Data Variants for Test PlanFRM_S4C_DBS4C Package for DDIC objects
CNV_10510_FCVMAPMappingtable for conversion of foreign currenciesCNV_10510Foreign Currencies Valuation
CNV_20100_T001CNV backup copy for T001CNV_20100CNCC: Chart of accounts conversion
CNV_20100_TKA01Backup copy - controlling areasCNV_20100CNCC: Chart of accounts conversion
CNV_20305_CEPCSAP LT: Backup table of CEPCCNV_20305Basis package for CO conversion packages
CNV_20305_T001backup table of T001 (certain fields only)CNV_20305Basis package for CO conversion packages
CNV_20305_TKA01backup table of TKA01 (certain fields only)CNV_20305Basis package for CO conversion packages
CNV_40305_POST_AAggregated amount to be repostedCNV_40305Asset transfer postings due to a change of account determ.
CNV_40305_POST_DValues to be reposted for a given assetCNV_40305Asset transfer postings due to a change of account determ.
CNV_40305_SIM_PAAggregated amount to be repostedCNV_40305Asset transfer postings due to a change of account determ.
CNV_40305_SIM_PDValues to be reposted for a given assetCNV_40305Asset transfer postings due to a change of account determ.
EWUCKMLWEMU: Currencies for material ledgerEWUAll objects for EURO conversion
EWUFIAASUMEWU conversion: Table for asset totals at account levelAEU0EMU development class: FI-AA
EWUMMFIEMU: transfer table for clearing entries MM-FIMEU0EURO conversion: Materials management
FLOG_SUPLRITEMField Logistics: Supplier Item RepositoryFLOG_SERVICESField Logistics Services
FLOG_SUPLRITEM_DDraft table for entity R_FLDLOGSSUPPLIERITEMTPFLOG_SERVICESField Logistics Services
FIEUD_GOODS_HEADSAFT:PT:XML:Goods Movement HeaderGLO-LOG-PTLogistics Localization forms for Portugal
FIEUD_GOODS_ITEMSAFT-XML:PT:Goods Movement Line ItemsGLO-LOG-PTLogistics Localization forms for Portugal
EDOBRCTEINCOMINGeDocument Brazil: CT-e Incoming DocumentGLO-EDO-BReDocument Brazil - Nota Fiscal
EDOCLRTFeDocument Chile RTFGLO-EDO-CLeDocument Chile
EDOCOINVINCeDocument Colombia: Invoice incomingGLO-EDO-COeDocument Colombia
EDOHULIMITSeDocument Hungary: Limits for Weight and ValueGLO-EDO-HUeDocument Hungary
EDOHUTRHDeDocument Hungary Transport Registration HeaderGLO-EDO-HUeDocument Hungary
EDOHUTRITeDocument Hungary Transport Registration ItemGLO-EDO-HUeDocument Hungary
EDOITINVINeDocument Italy: Incoming InvoiceGLO-EDO-ITeDocument Italy
EDOKRHOMETAXData from Home TaxGLO-EDO-KReDocument South Korea
EDOKRINVeDocument South Korea eInvoiceGLO-EDO-KReDocument South Korea
EDOKRINVSFeDocument South Korea Self Billing eInvoiceGLO-EDO-KReDocument South Korea
EDOKRINVSFPeDocument South Korea Self Billing for Purchaser eInvoiceGLO-EDO-KReDocument South Korea
J_3RL_NOTICETable to store the NoticeJ3RLLocalization Russia: Logistics
TXW_S_BKPFRetrieve BKPF from archiveFTW1Data Retention Tool
TXW_S_EKKORetrieve EKKO from archiveFTW1Data Retention Tool
TXW_S_MSEGRetrieve MSEG from archiveFTW1Data Retention Tool
ABPPAY_DRAFTI_ABPPAYMENTBATCHTP I_ABPPAYMENTTPODATA_BANK_PAYMENT_APPROVALBank Payment Approval
BTITEM_DRAFTI_BANKPAYMENTBATCHITEMTP I_BANKPAYMENTBATCHITEMTPODATA_MONITOR_PAYMENT_BATCHESoData Services - Payment Monitor
AVIP_DRAFTI_PAYMENTADVICETP I_PAYMENTADVICEITEMTPODATA_PAYMENTADVICESoData Services - Payment Advices
AVIP_DRAFTI_PAYMENTADVICETP I_PAYMENTADVICEITEMTPODATA_PAYMENTADVICESoData Services - Payment Advices
AVIR_DRAFTI_PAYMENTADVICETP I_PAYMENTADVICESUBITEMTPODATA_PAYMENTADVICESoData Services - Payment Advices
CSKS_DRAFTI_COSTCENTERTP I_COSTCENTERTPODATA_COST_CENTER_V2oData Services - Cost Center V2
UMIP_XLS_HEADERHeader Data From Uploaded Excel FileODATA_ML_UPLMATINVPRoData Services � Upload Material Inventory Prices
JVKONVIS-Oil / Joint Venture / Data table for CRP pricing dataGJVA
T8JBI_THJVA billing thresholdsGJV2
T8JBI_THDJVA billing threshold detailsGJV2
T8J_POST_ERROR_CDocuments with errors in JV posting (Open Items)GJV2
T8PSA_CALCalculation SchemeGJPSA
T8PSA_RU3_HISTPSA Rollup III History (for compression to a group venture)GJPSA
T8PSA_RUII_HISTPSA Rollup II History (for produc split by volume)GJPSA
JVB01JV Billing Extract: InvoiceGJVA_BILLINGBilling functionality for Joint Venture Accounting
JVB02JV Billing Extract: StatementGJVA_BILLINGBilling functionality for Joint Venture Accounting
JVB05JV Billing Extract: Invoice EDIGJVA_BILLINGBilling functionality for Joint Venture Accounting
JVB08JV Billing Extract: Suppl. Det. Invoice EDIGJVA_BILLINGBilling functionality for Joint Venture Accounting
JVB09JV Billing Extract: EDI Supplem. Detail - Expendit. DetailGJVA_BILLINGBilling functionality for Joint Venture Accounting
JVB25JV Billing Extract: Suppl. Det. InvoiceGJVA_BILLINGBilling functionality for Joint Venture Accounting
JVB26JV Billing Extract: Supplemental Detail - Expenditure DetailGJVA_BILLINGBilling functionality for Joint Venture Accounting
JVBX01JV Billing Extract: InvoiceGJVA_BILLINGBilling functionality for Joint Venture Accounting
JVBX02JV Billing Extract: StatementGJVA_BILLINGBilling functionality for Joint Venture Accounting
JVBX05JV Billing Extract: Invoice EDIGJVA_BILLINGBilling functionality for Joint Venture Accounting
JVBX08JV Billing Extract: Suppl. Det. Invoice EDIGJVA_BILLINGBilling functionality for Joint Venture Accounting
JVBX09JV Billing Extract: EDI Supplem. Detail - Expendit. DetailGJVA_BILLINGBilling functionality for Joint Venture Accounting
JVBX25JV Billing Extract: Suppl. Det. InvoiceGJVA_BILLINGBilling functionality for Joint Venture Accounting
JVBX26JV Billing Extract: Supplemental Detail - Expenditure DetailGJVA_BILLINGBilling functionality for Joint Venture Accounting
CNVA_PCREA_AA_RLT PC Reorg Analysis: Asset Reconciliation results (Level 1)CNVA_PCREALT Profit Center Reorganization Analysis
CNVA_PCREA_AA_RLT PC Reorg Analysis: Asset Reconciliation results (Level 1)CNVA_PCREALT Profit Center Reorganization Analysis
CNVA_PCREA_GRIROGR/IR Items - Results (Level 2)CNVA_PCREALT Profit Center Reorganization Analysis
CNVA_PCREA_WIP_OLT PC Reorg Analysis: WIP Reconciliation results (Level 2)CNVA_PCREALT Profit Center Reorganization Analysis
CNVA_PCREA_WIP_OLT PC Reorg Analysis: WIP Reconciliation results (Level 2)CNVA_PCREALT Profit Center Reorganization Analysis
CNVA_PCREA_WIP_RLT PC Reorg Analysis: WIP Reconciliation results (Level 1)CNVA_PCREALT Profit Center Reorganization Analysis
CNVA_PCREA_WIP_RLT PC Reorg Analysis: WIP Reconciliation results (Level 1)CNVA_PCREALT Profit Center Reorganization Analysis
CNVA_PCREA_WIP_RLT PC Reorg Analysis: WIP Reconciliation results (Level 1)CNVA_PCREALT Profit Center Reorganization Analysis
CNVA_PCREA_WIP_RLT PC Reorg Analysis: WIP Reconciliation results (Level 1)CNVA_PCREALT Profit Center Reorganization Analysis
IUUC_S4P_EKKOSOBSOLETECNV_DMC_DEACTIVATEDMWB: Deactivated Objects
IUUC_S4P_VBRKSOBSOLETECNV_DMC_DEACTIVATEDMWB: Deactivated Objects
BUT053_PRCMDC: Process table BUT053 - BP Rel. Company InterestMDC_BP_REL_MODELMaster Data Consolidation: BP Relationship Data Model
BUT053_SRCMDC: Source table BUT053 - BP Rel. Company InterestMDC_BP_REL_MODELMaster Data Consolidation: BP Relationship Data Model
LFB1_PRCMaster Data Consolidation: Process Table for LFB1MDC_BP_MODELMaster Data Consolidation: Business Partner Data Model
LFB1_SRCMaster Data Consolidation: Source Table for LFB1MDC_BP_MODELMaster Data Consolidation: Business Partner Data Model
CKMLCR_PRCProcess Records Of OTC 194, Table CKMLCRMDC_MAT_MODELMaster Data Consolidation: Material Data Model
CKMLCR_SRCSource Records Of OTC 194, Table CKMLCRMDC_MAT_MODELMaster Data Consolidation: Material Data Model
CATSDBCATS: Database Table for Time SheetCATS
CATS_TEMPCATS: Database Table for TemplatesCATS
CATS_V1_WORKLISTUser Defined Work ListODATA_HCM_CATS_MAN_V1OData Services for Timesheet Entry (TETRIS UI)
COPPP_ITMCO Postprocessing List - ItemsKIMBCost Accounting: Manual Actual Postings
FCO_OVHD_CNSHTDRI_RUNOVERHEADSTATISTICTP I_RUNOVERHEADCOSTINGSHEETTPODATA_OVERHEAD_CALC_SINGLEoData Services - Single Overhead Calculation
FCO_OVHD_VALDRI_RUNOVERHEADSTATISTICTP I_CONTROLLINGOVERHEADVALUETPODATA_OVERHEAD_CALC_SINGLEoData Services - Single Overhead Calculation
FCO_SETTLRCV_DRI_RUNSETTLMTACTLSTATISTICTP I_RUNSETTLEMENTACTLRECEIVERTPODATA_SETTLEMENToData Services - Settlement
FCO_SETTLSND_DRI_RUNSETTLMTACTLSTATISTICTP I_RUNSETTLEMENTACTLSENDERTPODATA_SETTLEMENToData Services - Settlement
FCO_SETTLVAL_DRI_RUNSETTLMTACTLSTATISTICTP I_RUNSETTLMTACTLSETTLEDVALUETPODATA_SETTLEMENToData Services - Settlement
CMDT_CCGeneric Master Data: Cost Center EnhancementsKBASOverhead Cost Controlling
TKAR1CO Resource Prices Valid for the Controlling AreaKBASOverhead Cost Controlling
TKAR2CO Resource Prices Per Cost CenterKBASOverhead Cost Controlling
CSKSCost Center Master RecordKBASCOREOverhead Cost Controlling: General Services
TKA01Controlling AreasKBASCOREOverhead Cost Controlling: General Services
ACCOSTRATECost RateFINS_CO_COST_RATEManagement Accounting - Cost Rate
COINT_TPOST_ITControlling Integration: Reposting: Line ItemsCOINT_TPReposting for Controlling Integration
CMDT_BPGeneric master record business process enhancementsKABCCost Accounting: Activity-Based Costing
CEERRORCO-PA: Incorrect records from SDKEProfitability Analysis
TKEBLAssignment: Ledger -> operating concernKEProfitability Analysis
TKELCO-PA ledgerKEProfitability Analysis
TKESVGlobal variablesKEProfitability Analysis
TKE_DIST_SRC_VFCOPA Distribution: Value Field AssignmentKEProfitability Analysis
TPSL_AC_RUN_02KEPSL, add curtp: parameters of productive runsKEPSLCombined Profitability Analysis
CKMLCRMaterial Ledger: Period Totals Records ValuesCKMLMaterial Ledger
CKMLCTCurrency Types and Valuation Types in a Valuation AreaCKMLMaterial Ledger
CKMLKEPHMaterial Ledger: Cost Component Split (Elements)CKMLCCSActual Cost Component Split
CKMLLACRML Activity Type: Period Record/Currency RecordCKMLLAUpdate of Activity Consumption in Quantity Structure
CKMLLACRML Activity Type: Period Record/Currency RecordCKMLLAUpdate of Activity Consumption in Quantity Structure
CKMLLACRLDML Activity Type: Period Record/Currency RecordCKMLLAUpdate of Activity Consumption in Quantity Structure
CKMLLACRLDML Activity Type: Period Record/Currency RecordCKMLLAUpdate of Activity Consumption in Quantity Structure
CKMLMYMPPeriodic Receipt Values for Consumption Sequence ProcedureCKMLBBBalance Sheet Valuation in Material Ledger
CKMLPRKEPHMaterial Ledger: Cost Component Split (Elements) for PricesCKMLCCSActual Cost Component Split
CKMLPRKEPHLDMat. Led. CCS (Elements) for Prices with LedgerCKMLCCSActual Cost Component Split
CKMLPR_EBPrices for Ending Inventory/Balance Sheet ValuationCKMLMaterial Ledger
CKMLWMaterial Ledger Currencies in Valuation AreaCKMLMaterial Ledger
CKMLWMaterial Ledger Currencies in Valuation AreaCKMLMaterial Ledger
CKMLWMaterial Ledger Currencies in Valuation AreaCKMLMaterial Ledger
MLAUFCRMaterial Ledger Currency Table for Order HistoryCKMLMaterial Ledger
MLAUFCRHHistory table for summerized MLAUFCR dataCKMLMaterial Ledger
MLAUFCRLDMat. Led. Currency Table for Order History icnl. LedgerCKMLMaterial Ledger
MLAUFCRLDHHistory table for summerized MLAUFCR data icnl. LedgerCKMLMaterial Ledger
MLAUFKEPHML: Cost Component Split (Components) for Order HistoryCKMLCCSActual Cost Component Split
MLAUFKEPHHHistory table for summarized MLAUFKEPH dataCKMLCCSActual Cost Component Split
MLAUFKEPHLDML: Cost Component Split for Order History icnl. LedgerCKMLCCSActual Cost Component Split
MLAUFKEPHLDHHistory table for summarized MLAUFKEPH data icnl. LedgerCKMLCCSActual Cost Component Split
MLBECRMaterial Ledger Currency Table for GR/IR relevant transact.CKMLMaterial Ledger
MLBECRHMaterial Ledger Currency Table for GR/IR relevant transact.CKMLMaterial Ledger
MLBECRLDMat. Led. Cur Table for GR/IR rel. transact. icnl. LedgerCKMLMaterial Ledger
MLBECRLDHMat. Led. Cur Table for GR/IR rel. transact. icnl. LedgerCKMLMaterial Ledger
MLBEKEPHML: Cost Comp. Split (Elements) for Purchase Order HistoryCKMLCCSActual Cost Component Split
MLCDMaterial Ledger: Summarization Record (from Documents)CKMLMaterial Ledger
MLCRMaterial Ledger Document: Currencies and ValuesCKMLMaterial Ledger
MLCRLDMaterial Ledger Document: Currency per Ledger and ValuesCKMLMaterial Ledger
MLKEPHML Document: Cost Component Split (Elements) for ValuesCKMLCCSActual Cost Component Split
MLKEPHLDML Document: CCS (Elements) for Values per LedgerCKMLCCSActual Cost Component Split
MLKEPLDHML Document: CCS (Elements) for Values per LedgerCKMLCCSActual Cost Component Split
MLPRKEPHML Document: Cost Component Split (Components)for PricesCKMLCCSActual Cost Component Split
MLPRKEPHLDML Document: CCS (Elements) for Prices per LedgerCKMLCCSActual Cost Component Split
MLPRKEPLDHML Document: CCS (Elements) for Prices per LedgerCKMLCCSActual Cost Component Split
CKMLCRWIPMaterial Ledger: WIP Period Records (Values)CO_ML_WIPWIP at Actual Costs
CKMLLACRWIPML Activity Types: Period/ Currency Records WIP (Values)CO_ML_WIPWIP at Actual Costs
CKMVFM_BSEG_OUTDisplay of FI Documents, Transaction CKMVFM, SAP Note 912984CO_ML_DISPLAYExtended Display of ML Data
CKMVFM_OUTOutput for the Value_Flow_Monitor, see SAP Note 912984CO_ML_DISPLAYExtended Display of ML Data
FCMLREPCKMLCRCorrection for ML-Helpdesk: CKMLCRFCML_HELPDESKMaterial Ledger Helpdesk
FCMLREPMLBECRCorrection for ML-Helpdesk: MLBECRFCML_HELPDESKMaterial Ledger Helpdesk
FCMLREPMLDOCCorrection for ML-Helpdesk: MLDOCFCML_HELPDESKMaterial Ledger Helpdesk
FCML_CCS_REPHDB Reporting Structure for MLFCML_ACCHDB Accelerator for Material Ledger
FCML_REPML Reporting StructureFCML_ACCHDB Accelerator for Material Ledger
MLDOCMaterial Ledger DocumentFCML4H_DOCUMENTActual Costing Document
MLDOCCCSMaterial Ledger Document Cost Component SplitFCML4H_DOCUMENTActual Costing Document
MLDOCCCS_EXTRACTExtract of Material Ledger Document Cost Component SplitFCML4H_DOCUMENTActual Costing Document
MLDOC_EXTRACTExtract of Material Ledger DocumentFCML4H_DOCUMENTActual Costing Document
MLPRICESPrice DataFCML4H_PRICESActual Costing Prices
MLPRICES_CCSCost Component Split of PricesFCML4H_PRICESActual Costing Prices
FMLT_CURTP_MLMaterial Ledger Currency Type Mapping related to ACDOCFINS_ML_CUSTMaterial Ledger - Customizing
MLWR(OBSOLETE) ML: line items of current period w/o UJEFINS_ML_DBMaterial Ledger - Database Layer
MLWRLD(OBSOLETE)ML: line items of current period w/o UJE w/ ledgerFINS_ML_DBMaterial Ledger - Database Layer
CKMLAVRDOCCRCumulation Posting Document: Currency InformationCO_ML_AVRMaterial Ledger Alternative Valuation Run
CKMLRUNSCALERe-scaling Amounts in the AVRCO_ML_AVRMaterial Ledger Alternative Valuation Run
CKMLRUNSCALERe-scaling Amounts in the AVRCO_ML_AVRMaterial Ledger Alternative Valuation Run
MLAVRSCALERe-scaling Amounts AVRCO_ML_AVRMaterial Ledger Alternative Valuation Run
MLAVRSCALERe-scaling Amounts AVRCO_ML_AVRMaterial Ledger Alternative Valuation Run
MLAVRSCALEKEPHCost Component Split of Re-scaling Amounts AVRCO_ML_AVRMaterial Ledger Alternative Valuation Run
MLAVRSCALEKEPHCost Component Split of Re-scaling Amounts AVRCO_ML_AVRMaterial Ledger Alternative Valuation Run
FCMLREPFMLTPRICECorrection for ML-Helpdesk: FMLT_PRICEFINS_ML_PRICE_TABLEMaterial Ledger - Price Table
FMLT_PRICEMaterial PriceFINS_ML_PRICE_TABLEMaterial Ledger - Price Table
FMLT_PR_HISTORYMaterial Price HistoryFINS_ML_PRICE_TABLEMaterial Ledger - Price Table
TKKABPosting Rules for Results Analysis DataKKAGCost Object Controlling Make-to-Order
FCO_DOC_POSFailure Cost Document ItemCO_OBJ_FCOFailure Cost Processing
FCO_DOC_POSFailure Cost Document ItemCO_OBJ_FCOFailure Cost Processing
FINS_TRR_SIMUTABTable for storing simulated values for Rev Rec MonFINS_REV_REC_OBSOLETERevenue Recognition - Obsolete Objects
CKPSUnit Costing ItemsKKEKCost Accounting: Unit Costing
KEKOProduct Costing - Header DataCKR/3 Application Development: PP Product Costing
CKTC_CBEWCosting Master Data - AttributesDI_CKTCConcurrent Costing
CEPCProfit Center Master Data TableKE1Profit Center Accounting
CMDT_PCGeneric Master Record: Profit Center EnhancementsKE1Profit Center Accounting
EPM_KPI_CATALOGKPIs Available in Company CatalogPLANT_MANAGERPlant Manager
FCOM_KFPRICEKey Figure PricesFCOM_EXP_SERVICESExpress Planning Services
ACCTCRCompressed Data from FI/CO Document - CurrenciesFBASFinancial Accounting "Basis"
AVIKPayment Advice HeaderFBASFinancial Accounting "Basis"
AVIPPayment Advice Line ItemFBASFinancial Accounting "Basis"
BFIT_A0FI Subseq.BA/PC Adjustmnt: Zero Bal.Postings for Bus.AreaFBASFinancial Accounting "Basis"
BFOD_ABFI Subseq.BA/PC Adjustmnt: Valuatn Diffrnce in Customer OIsFBASFinancial Accounting "Basis"
BFOK_ABFI subseq.BA/PC adjustmnt: Valuatn difference in vendor OIsFBASFinancial Accounting "Basis"
BKPFAccounting Document HeaderFBASFinancial Accounting "Basis"
BSAD_BAKAccounting: Secondary index for customers (cleared items)FBASFinancial Accounting "Basis"
BSAD_BCKAccounting: Secondary index for customers (cleared items)FBASFinancial Accounting "Basis"
BSAK_BAKAccounting: Secondary Index for Vendors (Cleared Items)FBASFinancial Accounting "Basis"
BSAK_BCKAccounting: Secondary index for vendors (cleared items)FBASFinancial Accounting "Basis"
BSAS_BAKAccounting: Secondary index for G/L accounts (cleared items)FBASFinancial Accounting "Basis"
BSAS_BCKAccounting: Secondary index for G/L accounts (cleared items)FBASFinancial Accounting "Basis"
BSEGAccounting Document SegmentFBASFinancial Accounting "Basis"
BSE_CLRAdditional Data for Document Segment: Clearing InformationFBASFinancial Accounting "Basis"
BSE_CLR_ASGMTDoc. Segment Add. Data: Clearing Info with Acct AssignmentFBASFinancial Accounting "Basis"
BSID_BAKAccounting: Secondary Index for CustomersFBASFinancial Accounting "Basis"
BSID_BCKAccounting: Secondary Index for CustomersFBASFinancial Accounting "Basis"
BSIK_BAKAccounting: Secondary index for vendorsFBASFinancial Accounting "Basis"
BSIK_BCKAccounting: Secondary index for vendorsFBASFinancial Accounting "Basis"
BSIPIndex for Vendor Validation of Double DocumentsFBASFinancial Accounting "Basis"
BSIS_BAKAccounting: Secondary Index for G/L AccountsFBASFinancial Accounting "Basis"
BSIS_BCKAccounting: Secondary Index for G/L AccountsFBASFinancial Accounting "Basis"
BWPOSIValuations for Open ItemsFBASFinancial Accounting "Basis"
EBKPFFin.Accntng Doc.Header (of Docs from Extern.Systems)FBASFinancial Accounting "Basis"
ICRC00_USER_PREFBalance Reconciliation: User-Specific SettingsFBASFinancial Accounting "Basis"
ICRC00_USER_PREFBalance Reconciliation: User-Specific SettingsFBASFinancial Accounting "Basis"
ICRC01Document Table for G/L Account ReconciliationFBASFinancial Accounting "Basis"
KMKPFFI: Account Assignment Model Header InformationFBASFinancial Accounting "Basis"
MHNDDunning DataFBASFinancial Accounting "Basis"
OBJECT_VALValuations for Valuation ObjectsFBASFinancial Accounting "Basis"
PARCTReceipt Log TableFBASFinancial Accounting "Basis"
T030DAcct Determ.for Open Item Exch.Rate DifferencesFBASFinancial Accounting "Basis"
T030EAcct Determ.for Open Item Exch.Rate DifferencesFBASFinancial Accounting "Basis"
T030HAcct Determ.for Open Item Exch.Rate DifferencesFBASFinancial Accounting "Basis"
T045EPresentation to BankFBASFinancial Accounting "Basis"
T056ZInterest RatesFBASFinancial Accounting "Basis"
T058AJapanese Stamp TaxFBASFinancial Accounting "Basis"
T059FFormulas for Calculating Withholding TaxFBASFinancial Accounting "Basis"
UKSDUser Control Totals (Online)FBASFinancial Accounting "Basis"
UKSDUser Control Totals (Online)FBASFinancial Accounting "Basis"
UKSDUser Control Totals (Online)FBASFinancial Accounting "Basis"
UKSDUser Control Totals (Online)FBASFinancial Accounting "Basis"
UKSDUser Control Totals (Online)FBASFinancial Accounting "Basis"
UKSDUser Control Totals (Online)FBASFinancial Accounting "Basis"
UKSDUser Control Totals (Online)FBASFinancial Accounting "Basis"
VBKPFDocument Header for Document ParkingFBASFinancial Accounting "Basis"
VBSEGDDocument Segment for Customer Document ParkingFBASFinancial Accounting "Basis"
VBSEGKDocument Segment for Vendor Document ParkingFBASFinancial Accounting "Basis"
VBSEGSDocument Segment for Document Parking - G/L Account DatabaseFBASFinancial Accounting "Basis"
VBWF01Company Code-Dependent Release DataFBASFinancial Accounting "Basis"
T001Company CodesFBZCOREPayments: General Services
T001RRounding Rules for Company Code and CurrencyFBASCOREFinancial Accounting General Services 'Basis'
FUDT_VDOCBKPFVerification Document HeaderEA_FIN_UI_DECO_API_VERIFYFrontend Backend Decoupling - APIs for Verification
FUDT_VDOCBKPFHVerification Document Header(History)EA_FIN_UI_DECO_API_VERIFYFrontend Backend Decoupling - APIs for Verification
FUDT_VDOCBSECLRHAdditional Data for Document Segment: Clearing InformationEA_FIN_UI_DECO_API_VERIFYFrontend Backend Decoupling - APIs for Verification
FUDT_VDOCBSE_CLRAdditional Data for Document Segment: Clearing InformationEA_FIN_UI_DECO_API_VERIFYFrontend Backend Decoupling - APIs for Verification
ICRCAICRC: Items to be ReconciledFB_ICRCCross-System Intercompany Reconciliation
ICRCUICRC: Potentially Differing Document GroupsFB_ICRCCross-System Intercompany Reconciliation
ICRCZICRC: Reconciled, Completed ItemsFB_ICRCCross-System Intercompany Reconciliation
ACCRBDAccruals/Deferrals Master Data - Basic DataACCRDevelopment Project 'Accrual/Deferral'
ACCRPOSTAccrual/deferral postingsACCRDevelopment Project 'Accrual/Deferral'
T090NHMaximum Amount MethodACAsset Accounting: Customizing
T091CTranslation methods for Asset AccountingAAAssets: Master Data
T093BCompany code-related depreciation area specificationsAAAssets: Master Data
FAAC_AMOUNT0FIAA: Amount SpecificationFINS_FAA_CFG_DBAsset Accounting: Configuration Persistency (DT & RT)
FAAT_DCTR_SEGAMTDepreciation Trace : Segment Amount, Period&Calculation ParaFINS_FAA_MD_VALUESFixed Asset Master: Values Display
/SAPPCE/TDPC01Down Payment Chains/SAPPCE/DPCDown Payment Chains
/SAPPCE/TDPC10Down Payment Chain: Contractual Penalties/SAPPCE/DPCDown Payment Chains
/SAPPCE/TDPC21Down Payment Chain: Document Segments/SAPPCE/DPCDown Payment Chains
/SAPPCE/TDPC22Down Payment Chain: Document Segment Currencies/SAPPCE/DPCDown Payment Chains
T059LRegional tax minimum amounts for 1099 reportingFBKVendors
FIAPPTD_KUKEYID administrationFBZPayments
FPIN_T_POSTENDatabase for Penalty Interest (Chorus)FIN_PINPenalty Interest
FPRL_ITEMItem DataFIN_PRLPayment Release List
PYORDHPayment order header dataFBZPayments
REGUHSettlement data from payment programFBZPayments
REGUPProcessed items from payment programFBZPayments
T042ABank selection for payment programFBZPayments
T042DAvailable amounts for payment programFBZPayments
T042IAccount determination for payment programFBZPayments
T042IYAccount Determination for Payment ProgramsFBZPayments
T042JBank charges determinationFBZPayments
T042KAccounts for bank chargesFBZPayments
T042SCharges/expenses for automatic pmnt transactionsFBZPayments
T042VValue date for automatic paymentsFBZPayments
IDFIPAYM_EOB_CDetermine External transaction - settings for payment sym.ID-FI-REU-PAYMFI Localization: Country-specific Payment Formats
T001RWTRounding rules for company code, withhold.tax type and curr.FQSTInfrastructure for withholding tax
T059FBFormulae for calculating withholding tax (new functions)FQSTInfrastructure for withholding tax
T059FBHW/tax formulae: HeaderFQSTInfrastructure for withholding tax
T059MINMAXMinimum and maximum amounts for withholding taxFQSTInfrastructure for withholding tax
FIWTGB_WHT_KEYMaintain withholding tax key and threshold limitID-FI-WTWithholding Tax reporting
FIWT_PARTNR_EXMTable for Vendor specific threshold amountsID-FI-WTWithholding Tax reporting
FIWT_TAX_AMOUNTTable to maintain withholding tax amountsID-FI-WTWithholding Tax reporting
J_1_T059WTKConstant Table for WithHolding TaxID-FI-WTWithholding Tax reporting
BSIWIndex table for customer bills of exchange usedFBDCustomers
BSIXIndex table for customer bills of exchange usedFBDCustomers
KNKACustomer master credit management: Central dataFBDCustomers
T014Credit control areasFBDCustomers
T045DAvailable amounts for bill of exchange presentationFBDCustomers
T045FBank selection for bill of exchange presentationFBDCustomers
T045GBank charges table for bill of exchange presentationFBDCustomers
T045LCharges table for bill/ex.presentation (country-specific)FBDCustomers
T056CFixed Amounts in Interest CalculationFB0CFinancial Accounting customers
T056FReference interest ratesFB0CFinancial Accounting customers
T056UControl table for calculation of interest on arrearsFB0CFinancial Accounting customers
TINSOFailed Payment Transactions and ChargesFBDCustomers
FINS_BAL_DUMMY2Dummy Table for CDS ViewFINS_OPS_UTILFinancial Operations - Utilities (SAP_FIN)
MHNKDunning data (account entries)FBMDunning
MHNKODunning data (acct entries) version before the next changeFBMDunning
T047CDunning chargesFBMDunning
T047HMarginal amountsFBMDunning
APARINTDOCTP_DRR_APARINTERESTDOCUMENTTP R_APARINTERESTDOCUMENTTPFINTNew Interest Calculation
INTITFXFixed Interest Amounts per InvoiceFINTNew Interest Calculation
INTITITInterest Calculation Details per ItemFINTNew Interest Calculation
INTITPFInterest Data per Form and PostingFINTNew Interest Calculation
T056SInterest scale interest terms (acct bal.int.calc.)FZNSFinancial Accounting interest scale
BSEGCDocument: Data on Payment Card PaymentsFBCCPayment cards
TCCLGPayment Cards: Settlement Run LogFBCCPayment cards
TCJ_BALANCEFI Cash Journal: Totals RecordsCAJO_LEDGERCash Journal Subledger
REGUTTemSe - Administration DataBFIBL_PAYMPayment medium
T012KHouse Bank AccountsBFIBL_BANKHouse Banks
TBCHAIN1Bank chainsFIBIBank chains
TBCHAIN2Bank Chains per Business Partner AccountFIBIBank chains
TBCHAIN21Bank chains per business partner account (allocation)FIBIBank chains
FIBL_RPCODEMaster Data for Repetitive CodeFIBL_RPCODERepetitive Codes
REGUHMPayment Data for Cross-Payment Run Payment MediumFIBL_MPAYPayment Media from Several Payment Runs
TCJ_C_JOURNALSCash JournalsCAJOCash Journal Development
TCJ_DOCUMENTSCash Journal Documents (Header Data)CAJOCash Journal Development
TCJ_MAX_AMOUNTCash Journal: Amount LimitCAJOCash Journal Development
TCJ_POSITIONSCash Journal Document ItemsCAJOCash Journal Development
PAYRPayment Medium FileBFIBL_CHECK_DPayment : General Section
REGUP_COREProcessed Items from Payment ProgramBFIBL_CHECK_DPayment : General Section
REGUP_COREProcessed Items from Payment ProgramBFIBL_CHECK_DPayment : General Section
T042ECompany Code-Specific Specifications for Payment MethodsBFIBL_CHECK_DPayment : General Section
T042WPermitted currency keys for payment methodBFIBL_PAYBank Subledger: Interface and Payments
T042YPAccount Determination for HR PaymentsBFIBL_PAYBank Subledger: Interface and Payments
FEBKOElectronic Bank Statement Header RecordsFTEBank accounting: External payment information
FEBKO_REVERSEDHeader of Reversed Bank StatementsFTEBank accounting: External payment information
FIEB_STMT_AZNUMBank Statements numbers for specific Msg Id'sFTEBank accounting: External payment information
T028ABank Statement TableFTEBank accounting: External payment information
T028MClass for alternative currency keysFTEBank accounting: External payment information
TFTE_BSM_CUSTCustomizing: Bank Statement MonitorFTEBank accounting: External payment information
T018VAcct Transfer: Determine Receiving Bank's Clearing AccountFMZAPayment program for payment requests
T042YAccount Determination for Bank to Bank PaymentsFMZAPayment program for payment requests
TBKFKFactory Calendar Identification Using CurrencyFMZAPayment program for payment requests
TBKPVTime Between Payment Run and Value Date at House BankFMZAPayment program for payment requests
FEB_ACTAcct Assignment TemplatesEA-FIN_EB_BSPROCElectronic Bank Statement - Postprocessing
FEB_REPRO_AVCOSTAverage Cost to Reprocess an Incoming PaymentEA-FIN_EB_BSPROC_CUSTElectronic Bank Statement - Postprocessing - Customizing
FEBKO_TRANSFERTransferred Bank StatementsFIN_EB_BSIMPElectronic Bank Statement - Import
FEB_ACCNT_SAVESaving of Posting Lines for Postprocessing (Account Assign.)FIN_EB_GENElectronic Bank Statement - General Functions
FEB_ITEM_SAVESaving of Posting Items for Postprocessing (On Account)FIN_EB_GENElectronic Bank Statement - General Functions
DFKCRPOClarification Worklist CreditFKK_CREDITFI-CA: Credit (example Processing, Clarification)
DFKKCFDUNTELTelephone List for DunningFKK_DUNNINGFI-CA: Dunning Run
DFKKCFRLSClarification Cases: Returns LotsFKK_RETURNSFI-CA: Returns
DFKKCFRLSClarification Cases: Returns LotsFKK_RETURNSFI-CA: Returns
DFKKCFZSTClarification Cases from Payment LotFKKBContract A/R & A/P: Central Objects
DFKKCJCCash Desk Closing DataFKK_CASH_JOURNALFI-CA: Cash Journal / Cash Desk
DFKKCJOOverpayment in For. Currency and Change in Local CurrencyFKK_CASH_JOURNALFI-CA: Cash Journal / Cash Desk
DFKKCJTTransaction Data for Cash JournalFKK_CASH_JOURNALFI-CA: Cash Journal / Cash Desk
DFKKCJT_WDRWHCash Journal: Historical Data for Withdrawal PostingFKK_CASH_JOURNALFI-CA: Cash Journal / Cash Desk
DFKKCLMEMManagement Table for Buffered Open Item ProcessingFKKBContract A/R & A/P: Central Objects
DFKKCMKManually Issued Checks Lot: Header DataFKK_CHECK_MANAGEMENTFI-CA: Check Management
DFKKCMPManually Issued Checks Lot: Item DataFKK_CHECK_MANAGEMENTFI-CA: Check Management
DFKKCOLI_LOGCollection Agency Information File: Communication LogFKK_COLL_AGENCYFI-CA: Collection Agencies
DFKKCOLLPAYMCollection PaymentsFKK_COLL_AGENCYFI-CA: Collection Agencies
DFKKCOLLPAYMLINKAssignment of Collection Payments to Collection UnitsFKK_COLL_AGENCYFI-CA: Collection Agencies
DFKKCOLLP_IP_WBuffer: Collection Agency Info File (Item for Payments)FKK_COLL_AGENCYFI-CA: Collection Agencies
DFKKCOLLP_IR_WBuffer: Collection Agency Info File (Item for Callback)FKK_COLL_AGENCYFI-CA: Collection Agencies
DFKKCOL_LOGCollections Agency File: Settlement Log (Payments)FKK_COLL_AGENCYFI-CA: Collection Agencies
DFKKCRRepository For ChecksFKK_CHECK_MANAGEMENTFI-CA: Check Management
DFKKCRRepository For ChecksFKK_CHECK_MANAGEMENTFI-CA: Check Management
DFKKCRCASHCR: Cashed Checks Not Yet Entered in RegisterFKK_CHECK_MANAGEMENTFI-CA: Check Management
DFKKCRCL_DOCSTable for Checks To Be ClarifiedFKK_CHECK_MANAGEMENTFI-CA: Check Management
DFKKCRDELCR: Deleted Payment Medium / Basic DataFKK_CHECK_MANAGEMENTFI-CA: Check Management
DFKKCRDELCR: Deleted Payment Medium / Basic DataFKK_CHECK_MANAGEMENTFI-CA: Check Management
DFKKCRDELD2Check Register: Deleted Payment Media/Partial EncashmentsFKK_CHECK_MANAGEMENTFI-CA: Check Management
DFKKCRDOC2Check Management: Partial EncashmentsFKK_CHECK_MANAGEMENTFI-CA: Check Management
DFKKCRESCHCClarification Cases for Manual Escheatment ProcessFKK_CHECK_MANAGEMENTFI-CA: Check Management
DFKKDEFREV_HEADHeader Table (Event-Based Deferred Revenues)FKK_DEFREVFI-CA: Deferred Revenues
DFKKDEFREV_POSLine Item Table (Event-Based Deferred Revenues)FKK_DEFREVFI-CA: Deferred Revenues
DFKKDEFREV_TRIGTrigger Table - Amounts (Event-Based Deferred Revenues)FKK_DEFREVFI-CA: Deferred Revenues
DFKKDISPAFICA-DM: Amounts Changes to Dispute CasesFKKB_DMContract Accts Receivable and Payable - Dispute Management
DFKKEPRTLog for Inconsistent FI-CA DocumentsFKK_SUPPORTFI-CA: Programs for Support
DFKKESRISR Payment SupplementFKKBContract A/R & A/P: Central Objects
DFKKEXCExternal Payment InformationFKKEXCExternal Cash Desk Services
DFKKEXCJCash Journal: Data Store for Inbound ServicesFKKEXCExternal Cash Desk Services
DFKKEXC_CLExternal Payment Information - Clearing ProposalsFKKEXCExternal Cash Desk Services
DFKKEXC_PAYINFOInformation for Payment MediumFKKEXCExternal Cash Desk Services
DFKKEXC_PAYINFOInformation for Payment MediumFKKEXCExternal Cash Desk Services
DFKKEXC_SUMExternal Payment Information: Totals RecordsFKKEXCExternal Cash Desk Services
DFKKEXC_SUM_HISTCash Desk Closing History (DFKKEXC_SUM)FKKEXCExternal Cash Desk Services
DFKKEXTDOCOfficial Document Number with AttributesFKKBContract A/R & A/P: Central Objects
DFKKEXTTAXControl Table for Update of External Tax SystemsFKKBContract A/R & A/P: Central Objects
DFKKEXTTMPTemporary Entries for Official Document NumberFKKBContract A/R & A/P: Central Objects
DFKKFAFactoring: Data for Business Partner ItemFKK_FACTORINGFI-CA: Factoring
DFKKFAHFactoring: Data for Business Partner Item (History)FKK_FACTORINGFI-CA: Factoring
DFKKFASFactoring: Simulated DataFKK_FACTORINGFI-CA: Factoring
DFKKFATFactoring: Total AmountsFKK_FACTORINGFI-CA: Factoring
DFKKFHFI-CA: Table of Fine HistoryFKKBContract A/R & A/P: Central Objects
DFKKFWKORRNCumul. Table for Adjustment and Inverse Postings (New)FKKBContract A/R & A/P: Central Objects
DFKKFWKORRN_LDAccumun. Table for Adjustment and Inverse Postings (Ledger)FKKBContract A/R & A/P: Central Objects
DFKKIAFI-CA: Database table for FKKIA - intrst suppFKK_INTERESTFI-CA: Interest
DFKKIAPTInterest Calculation: Log for Interest RunFKK_INTERESTFI-CA: Interest
DFKKIP_GRPPayment Specification: Header DataFKK_PAYMENT_SPECFI-CA: Payment Specification
DFKKIP_GRPHPayment Specification: Payment Data (History)FKK_PAYMENT_SPECFI-CA: Payment Specification
DFKKIP_ITMPayment Specification: Related ItemsFKK_PAYMENT_SPECFI-CA: Payment Specification
DFKKIP_ITMHPayment Specification: Deletions Not Yet ConfirmedFKK_PAYMENT_SPECFI-CA: Payment Specification
DFKKOPBEWFI-CA Foreign Currency ValuationFKKBContract A/R & A/P: Central Objects
DFKKOPBEWFI-CA Foreign Currency ValuationFKKBContract A/R & A/P: Central Objects
DFKKOPBEW_LDFI-CA Ledger-Specific Foreign Currency ValuationFKKBContract A/R & A/P: Central Objects
DFKKOPBEW_LDFI-CA Ledger-Specific Foreign Currency ValuationFKKBContract A/R & A/P: Central Objects
DFKKOPCCard Data Supplement for Business Partner ItemFKK_PAYMENT_CARDFI-CA: Functions for Payment with Payment Card
DFKKOPKCCard Data Appendix for FICA DocumentFKK_PAYMENT_CARDFI-CA: Functions for Payment with Payment Card
DFKKOPKCCard Data Appendix for FICA DocumentFKK_PAYMENT_CARDFI-CA: Functions for Payment with Payment Card
DFKKOPKCAPayment Card: Settlement ResultFKK_PAYMENT_CARDFI-CA: Functions for Payment with Payment Card
DFKKOPKCEAPayment Data: Parked Payment Advice NotesFKK_PAYMENT_CARDFI-CA: Functions for Payment with Payment Card
DFKKOPVZAgreed Payment AmountsFKKBContract A/R & A/P: Central Objects
DFKKPC_LOGIPayment Cards: Billing Log (Paid Items)FKK_PAYMENT_CARDFI-CA: Functions for Payment with Payment Card
DFKKPC_LOGPPayment Cards: Billing Log (Payments)FKK_PAYMENT_CARDFI-CA: Functions for Payment with Payment Card
DFKKPDCFI-CA: Postdated ChecksFKK_PDCFI-CA: Postdated Checks
DFKKPOHPayment Order: Header DataFKKBContract A/R & A/P: Central Objects
DFKKPOPPayment Order: Item DataFKKBContract A/R & A/P: Central Objects
DFKKPPPPayment Assignments to Promises to PayFKK_P2PFI-CA: Promise to Pay
DFKKPREPERRFailed Prepaid Balance Changes in SAP CCFKK_PREPAIDFI-CA: Prepaid Account
DFKKPRNHSEPA: Direct Debit Pre-Notifications (FI-CA)FKK_SEPAFI-CA: SEPA
DFKKPRQPayment RequestFKKB_ENContract accounting: Core objects ( language English)
DFKKPSP_LOGPPayment Service Provider: Billing Log (Payments)FKK_PAYMENT_SRVPROVFI-CA: Payment Service Provider
DFKKQSRIndividual Records for Withholding Tax ReportFKKBContract A/R & A/P: Central Objects
DFKKRA_LEGACYLegacy Data for Initial Load of Revenue AccountingFKK_RAFI-CA Integration with Revenue Accounting
DFKKRA_LEGACYCLegacy Data for the Initial Load of Rev. Acctg (Conditions)FKK_RAFI-CA Integration with Revenue Accounting
DFKKRA_LEGACYSFLegacy Data for Revenue Acctg Initial Load(Plned Fulfillmts)FKK_RAFI-CA Integration with Revenue Accounting
DFKKRA_RAI_COTransfer Records to Revenue Accounting (Conditions)FKK_RAFI-CA Integration with Revenue Accounting
DFKKRA_RAI_MITransfer Records to Revenue Accounting (Main Items)FKK_RAFI-CA Integration with Revenue Accounting
DFKKRHReturns HistoryFKK_RETURNSFI-CA: Returns
DFKKRKReturns lot: Header dataFKK_RETURNSFI-CA: Returns
DFKKRPReturns lot: Data for paymentFKK_RETURNSFI-CA: Returns
DFKKSTATTable for Temporary Statistics Data, for Mass ActivitiesFKKBContract A/R & A/P: Central Objects
DFKKSTATTable for Temporary Statistics Data, for Mass ActivitiesFKKBContract A/R & A/P: Central Objects
DFKKSTATTable for Temporary Statistics Data, for Mass ActivitiesFKKBContract A/R & A/P: Central Objects
DFKKSUMPosting totals from FI-CAFKK_GLTRANSFI-CA: G/L Transfer
DFKKWEBPEBPP: Payment Data for Payments via WebFKK_BILLER_DIRECTFI-CA: Biller Direct
DFKKZARepayment RequestFKKBContract A/R & A/P: Central Objects
DFKKZKPayment lot: Header dataFKKBContract A/R & A/P: Central Objects
DFKKZPPayment lot: Data for paymentFKKBContract A/R & A/P: Central Objects
DFKK_ACCADJAdjustment Postings when Implementing Acct Assgmt CharsFKKBContract A/R & A/P: Central Objects
DFKK_CASHREG_TCash Register: Cash DocumentsFKK_RKSVFI-CA: Cash Register Duty in Cash Journal
DFKK_DISCO_PROPHService Disconnection Requests: HeaderFKK_DISCOFI-CA: Disconnection / Reconnection
DFKK_DISCO_PROPIService Disconnection Requests: ItemsFKK_DISCOFI-CA: Disconnection / Reconnection
DFKK_DISCO_PROPIService Disconnection Requests: ItemsFKK_DISCOFI-CA: Disconnection / Reconnection
DFKK_DOC_EXTRFI-CA Documents - ExtractsFKKBContract A/R & A/P: Central Objects
DFKK_DUEGRIDOI - ReclassificationsFKKBContract A/R & A/P: Central Objects
DFKK_IPL_RATESInstallment Plan Key Date Recording (Installments)FKK_INST_PLANFI-CA: Installment Plan
DFKK_NEWACCADJObsolete: See DFKK_ACCADJFKKBContract A/R & A/P: Central Objects
DFKK_PCARDCard Data SupplementFKK_PAYMENT_CARDFI-CA: Functions for Payment with Payment Card
DFKK_RECLASSOI - ReclassificationsFKKBContract A/R & A/P: Central Objects
DFKK_RECO_PROPService Reconnection RequestsFKK_DISCOFI-CA: Disconnection / Reconnection
DFKK_VT_ICT: Items of Provider ContractFKK_VTContract in FI-CA
DFKK_VT_ICT: Items of Provider ContractFKK_VTContract in FI-CA
DPAYDPayment Program - Payments (Check of Direct Debit Limit)FKK_PAYMENT_RUNFI-CA: Payment Run
DPAYHPayment program - data for paymentFKK_PAYMENT_RUNFI-CA: Payment Run
DPAYPPayment program - data on paid itemFKK_PAYMENT_RUNFI-CA: Payment Run
FKKDEFREVTrigger Table for Deferred Revenue PostingsFKK_DEFREVFI-CA: Deferred Revenues
FKKMAEXDunning Exceptions Document LinesFKK_DUNNINGFI-CA: Dunning Run
FKKMAKODunning History HeaderFKK_DUNNINGFI-CA: Dunning Run
FKKMAZEDunning history of line itemsFKK_DUNNINGFI-CA: Dunning Run
FKKPREPACCMaster Data for Prepaid AccountFKK_PREPAIDFI-CA: Prepaid Account
FKKPREPACC_BALMgmt Record Balance/Rounding Carryforward for Prepaid AcctFKK_PREPAIDFI-CA: Prepaid Account
TFK001RRounding Rules for Company Code and CurrencyFKKBContract A/R & A/P: Central Objects
TFK007MMaximum TaxFKKBContract A/R & A/P: Central Objects
TFK042APayment Program: Bank SelectionFKK_PAYMENT_RUNFI-CA: Payment Run
TFK042AXLPayment Program: Bank Selection - ID (Values)FKK_PAYMENT_RUNFI-CA: Payment Run
TFK042CPayments/Dunning/Interest: Alternative CurrencyFKKBContract A/R & A/P: Central Objects
TFK042UPayment Medium: Internal Note to PayeeFKK_PAYMENT_MEDIUMFI-CA: Payment Medium
TFK042WPayment Program: Valid Currencies for Payment MethodFKK_PAYMENT_RUNFI-CA: Payment Run
TFK043Tolerances for Payment Differences, Payment NoticesFKKBContract A/R & A/P: Central Objects
TFK045BReturns ChargesFKK_RETURNSFI-CA: Returns
TFK045B_CReturns ChargesFKK_RETURNSFI-CA: Returns
TFK045CMaximum Amount DifferencesFKK_RETURNSFI-CA: Returns
TFK047CUpper/lower amounts for dunningFKK_DUNNINGFI-CA: Dunning Run
TFK047IChargesFKK_DUNNINGFI-CA: Dunning Run
TFK047I_CChargesFKK_DUNNINGFI-CA: Dunning Run
TFK047MFI-CA Dunning: Dunning ActivitiesFKK_DUNNINGFI-CA: Dunning Run
TFK047M_CFI-CA Dunning: Dunning ActivitiesFKK_DUNNINGFI-CA: Dunning Run
TFK047OUpper/lower amounts for dunningFKK_DUNNINGFI-CA: Dunning Run
TFK047WAmount Limits for DunningFKK_CMFI-CA: Collections Management
TFK056IMinimum Amounts for Interest Calculation RuleFKK_INTERESTFI-CA: Interest
TFK057FI-CA: Amount Limit Table for Interest CalculationFKK_INTERESTFI-CA: Interest
TFK059QEAdditional Withholding Tax : CharacteristicsFKKBContract A/R & A/P: Central Objects
TFK063ACharge Categories for Installment Plan SurchargesFKK_INST_PLANFI-CA: Installment Plan
TFK063ATCharge Schema for Installment Plan Surcharges (Text Table)FKK_INST_PLANFI-CA: Installment Plan
TFK100BCounter per Currency at Cash DeskFKK_CASH_JOURNALFI-CA: Cash Journal / Cash Desk
TFK100BTText Table for Count Template per Currency of Cash DeskFKK_CASH_JOURNALFI-CA: Cash Journal / Cash Desk
TFK113GClearing: Write-Off Statistical ItemsFKKBContract A/R & A/P: Central Objects
TFK113ZClearing: Usage of Non-Assignable PaymentsFKKBContract A/R & A/P: Central Objects
TFK119Clearing: Amount Check GroupFKKBContract A/R & A/P: Central Objects
TFK119KClearing: Amount Check Group HeaderFKKBContract A/R & A/P: Central Objects
TFK119KTClearing: Amount Check Group (Texts)FKKBContract A/R & A/P: Central Objects
TFKAVARWrite-Off Variants: Age and Amount GridFKK_WRITEOFFFI-CA: Write-Off
TFKAVARTWrite-Off Variants: Age and Amount GridFKK_WRITEOFFFI-CA: Write-Off
TFKCCCRPProcentual Calculation Rules for Payment Card ChargesFKKBContract A/R & A/P: Central Objects
TFKCCCRSScaled Amounts for Payment Card ChargesFKKBContract A/R & A/P: Central Objects
TFKP2PCRRounding Amounts for Categories of Promises to PayFKK_P2PFI-CA: Promise to Pay
TFKRFPRefill PackagesFKK_PREPAIDFI-CA: Prepaid Account
TFK_DISCO_CTRLGeneral Settings for Service Disconnection and ReconnectionFKK_DISCOFI-CA: Disconnection / Reconnection
CADISPCREDIT_DI_CADISPUTECASETP I_CADISPUTEDCREDITTPODATA_O2C_FICA_DISPUTE_MANAGEOData Services: Manage Dispute Cases
CADISPFLLWUP_DI_CADISPUTECASETP I_CADISPUTECASEFLLWUPPOSTINGTPODATA_O2C_FICA_DISPUTE_MANAGEOData Services: Manage Dispute Cases
CADISPPAYMENT_DI_CADISPUTECASETP I_CADISPUTEDPAYMENTTPODATA_O2C_FICA_DISPUTE_MANAGEOData Services: Manage Dispute Cases
T056ITime-dep.terms for interest calc.ruleFKKZInterest Calculation FI/ CA: Common Objects
T056JTime-dependent terms for interest calc.rule - accessFKKZInterest Calculation FI/ CA: Common Objects
FKK_SECSecurity DepositFKK_SECURITYContract A/R & A/P: Security Deposits
FKK_KONV_SHORTPrice Conditions for SD Billing Document - ExtractsFKKIContract Accounts Receivable and Payable: Interface SD/FI-CA
FKKPREPACC_BALTUpdate Requests for Balance Carryfwd for Prepaid AccountFKKINVInvoicing
CFIN_ACDOC_ITCFIN View on /AIF/PERS_XML: Accounting Document Line ItemFINS_CFIN_TMP_POST_UICentral Finance - Temporary Postings Fiori UI
CFIN_TMP_ITchangeable item data for temporary postingsFINS_CFIN_TMP_POST_BLCentral Finance - Temporary Postings Business Logic
CFIN_TMP_IT_DDraft table for entity R_CFINTEMPORARYPOSTINGITEMTPFINS_CFIN_TMP_POST_BLCentral Finance - Temporary Postings Business Logic
CFIN_AVSI_ACCASESupplier Invoice - 3rd Party - Account AssignmentFINS_CFIN_ACC_VIEW_EXCentral Finance - External Interface for Accounting View
CFIN_AVSI_DOCECFin Source System of Rpld Supplier Invoice (API) DBFINS_CFIN_ACC_VIEW_EXCentral Finance - External Interface for Accounting View
CFIN_AVSI_ITEMECFin Rpld Supplier Invoice Item (API)FINS_CFIN_ACC_VIEW_EXCentral Finance - External Interface for Accounting View
CFIN_AV_PO_RORelated Object for Purchasing DocumentFINS_CFIN_ACC_VIEWCentral Finance - Accounting View
CFIN_AV_PO_ROOTPurchasing Document HeaderFINS_CFIN_ACC_VIEWCentral Finance - Accounting View
CFIN_AV_PRC_ELEMPricing ElementsFINS_CFIN_ACC_VIEWCentral Finance - Accounting View
CFIN_AV_SI_ROOTSupplier Invoice: Header DataFINS_CFIN_ACC_VIEWCentral Finance - Accounting View
CFIN_ACCCRTransfer TableFIN_CFIN_INTEGRATIONCentral Finance � Integration
CFIN_ACCITTransfer Table for ACCITFIN_CFIN_INTEGRATIONCentral Finance � Integration
CFIN_ACCITTransfer Table for ACCITFIN_CFIN_INTEGRATIONCentral Finance � Integration
CFIN_ACCIT_APPTransferTable: Appends to ACCITFIN_CFIN_INTEGRATIONCentral Finance � Integration
CFIN_ACCIT_CCSTransfer Table for ACCIT_CCSFIN_CFIN_INTEGRATIONCentral Finance � Integration
CFIN_ACCIT_CCSTransfer Table for ACCIT_CCSFIN_CFIN_INTEGRATIONCentral Finance � Integration
CFIN_ACCIT_PDSTransfer Table for ACCIT_PDSFIN_CFIN_INTEGRATIONCentral Finance � Integration
CFIN_ACCIT_REFECFIN: Transfer Table for ACCIT_REFERENCEFIN_CFIN_INTEGRATIONCentral Finance � Integration
CFIN_AUSZ_CLRCFIN: Transfer table for AUSZ_CLR (Clearing Info)FIN_CFIN_INTEGRATIONCentral Finance � Integration
CFIN_SPLINFO_VTransfer table for Splitt-Info ValuesFIN_CFIN_INTEGRATIONCentral Finance � Integration
FINS_CFIN_T001Central Finance: Company Code ConfigurationFINS_CFIN_CONFIG_CONSISTENCYCentral Finance - Configuration Consistency
FINS_CFIN_T001RWCentral Finance: Rounding rules WHT ConfigurationFINS_CFIN_CONFIG_CONSISTENCYCentral Finance - Configuration Consistency
FINS_CFIN_T059FBCentral Finance: Formulae for calc. WHT ConfigurationFINS_CFIN_CONFIG_CONSISTENCYCentral Finance - Configuration Consistency
FINS_CFIN_T059MMCentral Finance: Min. and max. amounts WHT Configuration KeyFINS_CFIN_CONFIG_CONSISTENCYCentral Finance - Configuration Consistency
FINS_CFIN_TCURXCentral Finance: Currency decimal settings in source systemFINS_CFIN_CONFIG_CONSISTENCYCentral Finance - Configuration Consistency
CFGIN_BP_O001for eCATT /SMB14/IN_BP_O001FINS_GEN_CONT_ACTIVContent Activation
CFGIN_BP_O001for eCATT /SMB14/IN_BP_O001FINS_GEN_CONT_ACTIVContent Activation
CFG_FIN_BAM_AMDCBC: C-table for RC CL_FINS_CNTACT_BAM_AMDFINS_GEN_CONT_ACTIVContent Activation
CFG_FIN_KP26CBC: C-table for RC CL_FINS_CNTACT_FCO_PLN_COST_RAFINS_GEN_CONT_ACTIVContent Activation
CFG_FIN_UKMBPCBC: C-table for RC CL_FINS_CNTACT_UKM_DB_UKMBP_CMFINS_GEN_CONT_ACTIVContent Activation
CFG_FIN_UKMBPCBC: C-table for RC CL_FINS_CNTACT_UKM_DB_UKMBP_CMFINS_GEN_CONT_ACTIVContent Activation
CFG_FIN_UKMBPCBC: C-table for RC CL_FINS_CNTACT_UKM_DB_UKMBP_CMFINS_GEN_CONT_ACTIVContent Activation
CFG_FIN_UKMBPCBC: C-table for RC CL_FINS_CNTACT_UKM_DB_UKMBP_CMFINS_GEN_CONT_ACTIVContent Activation
CFG_FIN_UKMBPCBC: C-table for RC CL_FINS_CNTACT_UKM_DB_UKMBP_CMFINS_GEN_CONT_ACTIVContent Activation
CFG_FIN_UKMBPCBC: C-table for RC CL_FINS_CNTACT_UKM_DB_UKMBP_CMFINS_GEN_CONT_ACTIVContent Activation
CFG_FIN_UKMBPCBC: C-table for RC CL_FINS_CNTACT_UKM_DB_UKMBP_CMFINS_GEN_CONT_ACTIVContent Activation
CFG_FIN_UKMBPCBC: C-table for RC CL_FINS_CNTACT_UKM_DB_UKMBP_CMFINS_GEN_CONT_ACTIVContent Activation
ANLA_DI_FIXEDASSETTP I_FIXEDASSETTPODATA_AA_ASSET_MANAGEoData Services - FIAA Asset Master List
ANLB_DI_FIXEDASSETTP I_FIXEDASSETDEPRAREATPODATA_AA_ASSET_MANAGEoData Services - FIAA Asset Master List
FAP_RSIV_FORCASRforcast lines of posting of recurring supplier invoicesODATA_RECUR_SUPPLIER_INVOICESoData Service - Manage Recurring Supplier Invoices
FAP_RSIV_FORCR_DR_RECRRGSUPLRINVCTMPLTP R_RECRRGSUPLRINVCTMPLINSTCETPODATA_RECUR_SUPPLIER_INVOICESoData Service - Manage Recurring Supplier Invoices
FAP_RSIV_GLLINERG/L line items of recurring supplier invoice templateODATA_RECUR_SUPPLIER_INVOICESoData Service - Manage Recurring Supplier Invoices
FAP_RSIV_WITHR_DR_RECRRGSUPLRINVCTMPLTP R_RECRRGSUPLRINVCTMPLWHGDTAXTPODATA_RECUR_SUPPLIER_INVOICESoData Service - Manage Recurring Supplier Invoices
FAP_RSIV_WITHTARWithholding tax of recurring supplier invoice templateODATA_RECUR_SUPPLIER_INVOICESoData Service - Manage Recurring Supplier Invoices
FEBKO_DRAFTBank Statement Root (draft)ODATA_BANKSTATEMENToData Services - Manage Bank Statement
FEBKO_DRAFT_V2I_ARBANKSTATEMENTTP I_ARBANKSTATEMENTTPODATA_BANKSTATEMENToData Services - Manage Bank Statement
BPIGBudget Object Index (Overall Budget)KABPBudgeting Funds Management/Cost Accounting
BPIJBudget Object Index (Annual Budget)KABPBudgeting Funds Management/Cost Accounting
FIWF_AMGRPAmount Groups for FI Role DefinitionFMEUEarmarked Funds: Additional Developments
FMCFAATR-FM: Commitments/Budget Carried ForwardFMBSFIFM: Basis
FMCFAASTR-FM: Commitments/Budget Carried Forward (Interim Storage)FMBSFIFM: Basis
FMCFAAS_TRTR-FM: Commitments/Budget Carried Forward (Interim Storage)FMCF_COREFM: Closing Operations (Core Objects)
FMCFAA_TRTR-FM: Commitments/Budget Carried ForwardFMCF_COREFM: Closing Operations (Core Objects)
FMCFABTR-FM: Commitments/Budget Carried Forward (Sender+Receiver)FMBSFIFM: Basis
FMCFABSTR-FM: Transferred Commitment/Budget (Senders+Receivers)FMBSFIFM: Basis
FMCFABS_TRTR-FM: Transferred Commitment/Budget (Senders+Receivers)FMCF_COREFM: Closing Operations (Core Objects)
FMCFAB_TRTR-FM: Commitments/Budget Carried Forward (Sender+Receiver)FMCF_COREFM: Closing Operations (Core Objects)
KBLESUMTotals Table KBLEFMREEarmarked funds
KBLEWItem development amounts in various currenciesFMREEarmarked funds
KBLPWDocument item amounts in different currenciesFMREEarmarked funds
TBP0LBudget/Planning LedgerKABPBudgeting Funds Management/Cost Accounting
FJEPGOODSMOVITGoods Movement Accounting Notification ItemFINS_JEP_APIAPI for journal entry processing
GLE_MCA_T030HGLE MCA Accounts TableFAGL_MCA_PER_GENFI: MCA General Functions - Persistency
GLE_MCA_ME_CREATManual entry dataFAGL_MCA_PER_MEFI: MCA manual entry - Persistency Layer
GLE_MCA_DELTAITMMCA Document Delta ItemsFAGL_MCA_PER_PLFI: MCA P&L Processing - Persistency
FAGL_SPLINFO_VALSplitting Information of Open Item ValuesFAGL_ONLINE_SPLITTEROnline Splitter in New General Ledger
SKM1Sample G/L accountsFBSG/L Accounts
T051AAccount Balances for Statutory ReportingFBMWExternal Statutory Reporting
BKPF_ADDAccounting Document HeaderFAGL_DB_PERSISTENCYDB Tables + Read/Write Accesses for FI Documents
FINSC_001ACurrency conversion settings for company codeFINS_ACDOC_CUSTUnified Journal Entry - Customizing
FINSC_001A_REPCurrencies of company code (Auxiliary table for Reporting)FINS_ACDOC_CUSTUnified Journal Entry - Customizing
FINSC_CURR_CHNGETask: Add or Remove Currency Types in ACDOCA Table EntriesFINS_ACDOC_CUSTUnified Journal Entry - Customizing
FINSC_CURR_CHNGETask: Add or Remove Currency Types in ACDOCA Table EntriesFINS_ACDOC_CUSTUnified Journal Entry - Customizing
FAGLBSAS_BAKAccounting: Secondary Index for G/L Accounts (Cleared Items)FAGL_POSTING_SERV_EHP3_SFWC_DDPosting Services: DDIC Switch
FAGLBSAS_BCKAccounting: Secondary index for G/L accounts (cleared items)FAGL_POSTING_SERV_EHP3_SFWC_DDPosting Services: DDIC Switch
FAGLBSIS_BAKAccounting: Secondary Index for G/L AccountsFAGL_POSTING_SERV_EHP3_SFWC_DDPosting Services: DDIC Switch
FAGLBSIS_BCKAccounting: Secondary Index for G/L AccountsFAGL_POSTING_SERV_EHP3_SFWC_DDPosting Services: DDIC Switch
FDC_D_DFT_AC_PYDDraft persistence of Accounting Document Payment DifferenceFINS_FI_DECOUI Decoupling FI Posting
FDC_D_GLITM_DRFTHold Data Persistence for GLITEMSFINS_FI_DECOUI Decoupling FI Posting
FBRC0060Reconciliation Processes: User SettingsFB_RCReconciliation Tool
BSBW_VALValuations for Accrual ObjectsFAGL_CLOSING_ACTIVITIESClosing Activities in FI
FAGL_BSBW_HST_BLValuation History of BalancesFAGL_CLOSING_ACTIVITIESClosing Activities in FI
FAGL_T030TRCustomizing for Balance TranslationFAGL_CLOSING_ACTIVITIESClosing Activities in FI
FAGL_EXTRDocuments for Summary Document TransferFAGL_DISTR_SCEN_1Distribution Scenario: Transfer of Totals Docs + Single Docs
PURORDACCR_DRAFTI_PURORDACCRSACCRSUBOBJECTTP I_PURORDACCRSACCRSUBOBJECTTPFI_GL_POACPurchase Order Accruals
ACE_SOP_BSMODATAData for the Black & Scholes ModelFI-SOAStock Option Accounting
ACE_SOP_INDTYPEType of Index Used for Award ProgramFI-SOAStock Option Accounting
BWPOSValuations for Open ItemsFREPRF reporting
DKKOPBalance Audit TrailFREPRF reporting
DKKOSBalance Audit TrailFREPRF reporting
DKOKPOpen Item Account Balance Audit TrailFREPRF reporting
DKOKSOpen Item Account Balance Audit Trail Master RecordFREPRF reporting
DSKOPBalance Audit TrailFREPRF reporting
DSKOSBalance Audit TrailFREPRF reporting
RFSCASHCash Book tableFREPRF reporting
T007JTax Advance Payment per Taxes on Sls/Pur.Grp and Cal.YrFREPRF reporting
T030HBAcct Determ.for Open Item Exch.Rate DifferencesFREPRF reporting
T044EForeign Currency Valuation: Items with Special CoverFREPRF reporting
TBKOWValuation Difference Temporary StorageFREPRF reporting
TEURBAltern. Local Currency and Exch.Rate Type for a Company CodeFREPRF reporting
UMSVTax Balances per Comp.Code, Tax Code and Process.KeyFREPRF reporting
FAGL_BW_LOG_ITEMFI-GL: Log for BW Extraction: Line ItemsGBIW_ERPExtractors for General Ledger in ERP
FAGL_BW_LOG_ITEMFI-GL: Log for BW Extraction: Line ItemsGBIW_ERPExtractors for General Ledger in ERP
FAGL_R_APAR_VALReorg: Values for Receivables and Payables Object ListFAGL_REORGANIZATION_FWReorganization - Framework
FAGL_R_BLNCE_VALReorganization: Balances to Be Transferred - ValuesFAGL_REORGANIZATION_FWReorganization - Framework
FAGL_R_SPL_VALReorganization: Splitting Information of Open Item ValuesFAGL_REORGANIZATION_FWReorganization - Framework
FILA_GF_ITEMDATAProcess DataFI_LA_GFLease Accounting General Functions
FILA_GF_ITEMDATAProcess DataFI_LA_GFLease Accounting General Functions
LAE_BILLING_DATPayment ScheduleFI_LA_GFLease Accounting General Functions
LAE_BILLING_DATAPayment ScheduleFI_LA_GFLease Accounting General Functions
LAE_CRM_BILLPLANPayment ScheduleFI_LA_GFLease Accounting General Functions
LAE_CRM_CONDSLease-Accounting-Relevant ConditionsFI_LA_GFLease Accounting General Functions
LAE_CRM_ITEMSLAE: Contract ItemsFI_LA_GFLease Accounting General Functions
FILA_RE_PRGRefinancing ProgramFI_LA_RE_APPLApplications for the Refinancing Solution
FILA_RE_TR_HTranche Header: Selection Result for RefinancingFI_LA_RE_APPLApplications for the Refinancing Solution
GSBLCABusiness area consolidation: deviating recordsFKUCFI-LC Consolidation: Unicode-Capable Objects
J_1AINFT16Warehouse report ( data of previous fiscal years )J1AIExtended Inflation (FI)
J_1AOIFWVLOpen item foreign currency valuation: temp. storageJ1AIExtended Inflation (FI)
TIVXCJPCCSETCompany-Specific Data CustomizingGLO_REFX_JPLocalization Flexible Real Estate Japan
TIVXCNLSUBSICATDefine Categories for Subsidized RentGLO_REFX_NL_DDICLocalization Flexible Real Estate Netherlands
TIVXCPTEXPERExemption periods (obsolete)GLO_REFX_PT_DDICLocalization Flexible Real Estate Portugal
TIVXCPTINSTLIMITInstallment limit for the Municipal Property TaxGLO_REFX_PT_DDICLocalization Flexible Real Estate Portugal
VIXCCHCATASTERLocalization Switzerland: RE Property CatasterGLO_REFX_CH_GWRLocalization Flexible Real Estate Switzerland - GWR
VIXCJPFXDUNPRICEFixed Unit Prices for Service Charge SettlementGLO_REFX_JPLocalization Flexible Real Estate Japan
VIXCJPSCCOSTSEXTCosts per Object - Legacy Data TransferGLO_REFX_JPLocalization Flexible Real Estate Japan
VIXCJPSCCOSTSEXTCosts per Object - Legacy Data TransferGLO_REFX_JPLocalization Flexible Real Estate Japan
VIXCPTIMIDATAIMI Master DataGLO_REFX_PT_DDICLocalization Flexible Real Estate Portugal
VIXCESCDLOGLog of Secure Deposit FilesGLO_REFX_ES_RALocalization Flexible Real Estate Spain
VIXCESIBIDATAIBI master dataGLO_REFX_ES_RALocalization Flexible Real Estate Spain
VIXCESM180DECModelo 180 - Witholding Tax Declarer Line 01GLO_REFX_ES_RALocalization Flexible Real Estate Spain
VIXCESM180RECModelo 180 - Witholding Tax Recipients DMEE Line 02GLO_REFX_ES_RALocalization Flexible Real Estate Spain
GLO_FAAD_MD_TDDI_ASSETTP I_GLOBASSETASSIGNMENTTPGLO_FIN_FAA_GENGlobalization Fixes Assets: General
J_1B_CIAP_FACTORCIAP FactorID-CIAP-BRCIAP solution for Brasil
J_1B_CIAP_OBJECTCIAP document dataID-CIAP-BRCIAP solution for Brasil
IDIN_ASSETTRNSAsset Transaction Table for India (Block Level)ID-FIAA-INFIAA Localization # India
IDIN_FIAA_ADJUSTAdjustment values for the block and opening WDV - IndiaID-FIAA-INFIAA Localization # India
IDIN_FIAA_WDV_FYFI-AA India : Opening WDV for the blocks - TransactionsID-FIAA-INFIAA Localization # India
IDPT_A071Limit for assets which use Electric/Hybrid/GPL & GNV/OthersID-FIAA-PTFI-AA Localization (Portugal)
/SAPCE/FKUA_TCLRTax Report data for cash method - localization Ukraine/SAPCE/FKUAFI-CA localization Ukraine
/SAPCE/FKUA_TXKOHeader of Tax Invoice - localisation Ukraine/SAPCE/FKUAFI-CA localization Ukraine
/SAPCE/FKUA_TXOPItem of Tax Invoice - localization Ukraine/SAPCE/FKUAFI-CA localization Ukraine
/SAPCE/FK_NDCRNNondelivered Credit Memo Data (with History)/SAPCE/FK_REUFI-CA localization Reused Objects
/SAPCE/FK_SLOZNASet B cheques/SAPCE/FKCZSKFI-CA localization Czech Republic, Slovakia
FKKID_WHTSP_CFICA loc.:Additional Settings for WHT Code & Suppl.FKK_ID_XX_WHTFI-CA Localization Cross-Country: Withholding Tax
DFKKBOHBoleto: Header dataFKK_LOCAL_BRA_BOLETOBrazil Localization - Boleto
DFKKBOL_BANKIDBoleto: Bank ID Determination ResultsFKK_LOCAL_BRA_BOLETOBrazil Localization - Boleto
DFKKBOPBoleto: Item DataFKK_LOCAL_BRA_BOLETOBrazil Localization - Boleto
DFKKBRLEVYRECLevy Way: Data from Payment Lot for Levy Way report (Brazil)FKK_ID_BRFI-CA: Country specific development (Brazil)
TFK059BRACThreshold Limits for Withholding Tax Code & Suppl. Tax CodeFKK_ID_BR_WHTFI-CA: Country specific functions Brazil Withholding Tax
TFK059BRFSFormulas for Withholding Tax CalculationFKK_ID_BR_WHTFI-CA: Country specific functions Brazil Withholding Tax
TFK059BRFSHFormulas for Withholding Tax: HeaderFKK_ID_BR_WHTFI-CA: Country specific functions Brazil Withholding Tax
TFKKBRFEBRSPBrazil Insurance Febraban - File Split limit amountsFKK_ID_BR_PYMNT_INSFI-CA: Brazil specific development Payment
FKKID_ACCU_TAX_IIndia: Tax accumulation table - detailsFKK_ID_INFI-CA: Country specific development (India)
DFKKSAFTINV_HSAF-T Source Document: HeaderFKK_ID_PT_SAFTFI-CA Localization Portugal - SAF-T
DFKKSAFTPAY_HSAF-T Payment Source Document: HeaderFKK_ID_PT_SAFTFI-CA Localization Portugal - SAF-T
DFKKSAFTWD_HSAF-T Working Documents: HeaderFKK_ID_PT_SAFTFI-CA Localization Portugal - SAF-T
/SAPCE/FKRUCKDCustom table for exchange rate difference VAT report. Russia/SAPCE/FKRUFI-CA localization Russia
CMCBC_CBAREACash Budgeting AreaEA_FIN_CM_CB_PLANNING_SRVService for Cash Budgeting
CMCBC_NOTIFY_CTLCash Budgeting Notification and Alert ControlEA_FIN_CM_CB_PLANNING_SRVService for Cash Budgeting
CMCBD_BGT_CLAIMBudget claims based on suggest levelEA_FIN_CM_CB_PLANNING_SRVService for Cash Budgeting
CMCBD_BRF_LINKSCash Budget Workflow Node Links for BRF+EA_FIN_CM_CB_PLANNING_SRVService for Cash Budgeting
CMCBD_CONSUMECash Budgeting ConsumptionEA_FIN_CM_CB_PLANNING_SRVService for Cash Budgeting
CMCBD_CONSUMELOGCash Budgeting Consumption HistoryEA_FIN_CM_CB_PLANNING_SRVService for Cash Budgeting
CMCBD_ENTRY_HISTCash Budgeting Entry HistoryEA_FIN_CM_CB_PLANNING_SRVService for Cash Budgeting
CMCBD_ORG_UNITOrganizational UnitEA_FIN_CM_CB_PLANNING_SRVService for Cash Budgeting
CMCBD_WF_ORGCash Budgeting Org InfoEA_FIN_CM_CB_PLANNING_SRVService for Cash Budgeting
CMCBD_WKLIST_TKWork List: Tasks TableEA_FIN_CM_CB_PLANNING_SRVService for Cash Budgeting
RDSV_DS_BKPFRDSV Digital Signature (FI)ID-RDSV-XXRegulatory Document and Signature Validation
RDSV_DS_VBRKRDSV Digital Signature (SD)ID-RDSV-XXRegulatory Document and Signature Validation
RDSV_DS_VBRK_EXTRDSV External Digital Signature (SD)ID-RDSV-XXRegulatory Document and Signature Validation
SND_AO_MOG_HSAF-T AO: Movement of Goods HeaderID-SAFT-AO-MOGSAF-T Angola MOG
SND_AO_MOG_ISAF-T AO: Movement of Goods ItemID-SAFT-AO-MOGSAF-T Angola MOG
VIXCAOSAFTHSAF-T AO: RE-FX Invoices HeaderGLO_REFX_AOLocalization Flexible Real Estate Angola
SND_AO_ACQ_FI_HSAF-T AO: Acquisitions FI Invoices HeaderID-SAFT-AOSAF-T Angola
SND_AO_ACQ_MM_HSAF-T AO: Acquisitions MM Invoices HeaderID-SAFT-AOSAF-T Angola
SND_AO_FI_HSAF-T AO: FI Invoices HeaderID-SAFT-AOSAF-T Angola
SND_AO_GLE_HSAF-T AO: G/L Entries HeaderID-SAFT-AOSAF-T Angola
SND_AO_HEADERSAF-T AO : Header (consolidation)ID-SAFT-AOSAF-T Angola
SND_AO_PY_FI_HSAF-T AO: FI payments HeaderID-SAFT-AOSAF-T Angola
PAYREQN_PAYITMDDraft Table for entity R_CN_RequisitionPaymentItemTPGLO_FIN_PAY_REQN_CNGlobalization Financials Payment Requisition for China
PAYREQN_PAYNOTEDDraft Table for entity R_CN_RequisitionPaymentNoteTPGLO_FIN_PAY_REQN_CNGlobalization Financials Payment Requisition for China
PAYREQN_PAYSTGYPayment Requisition: Payment StrategyGLO_FIN_PAY_REQN_CNGlobalization Financials Payment Requisition for China
PAYREQN_PAYSTGYDDraft Table for entity R_CN_RequisitionPayStrategyTPGLO_FIN_PAY_REQN_CNGlobalization Financials Payment Requisition for China
PAYREQN_REQNPayment RequisitionGLO_FIN_PAY_REQN_CNGlobalization Financials Payment Requisition for China
PAYREQN_REQNDDraft table for entity R_CN_PaymentRequisitionTPGLO_FIN_PAY_REQN_CNGlobalization Financials Payment Requisition for China
PAYREQN_REQNITMPayment Requisition: Requisition ItemGLO_FIN_PAY_REQN_CNGlobalization Financials Payment Requisition for China
PAYREQN_REQNITMDDraft Table for entity R_CN_RequisitionItemTPGLO_FIN_PAY_REQN_CNGlobalization Financials Payment Requisition for China
BOE_ACTION_REQBoe action requestEA_FIN_CM_BOE_SRVBusiness Objects for Bill of Exchange
BOE_BLANK_NOTESBlank NotesEA_FIN_CM_BOE_SRVBusiness Objects for Bill of Exchange
BOE_COL_ITEMCollection item data tableEA_FIN_CM_BOE_SRVBusiness Objects for Bill of Exchange
BOE_CUS_ITEMCustody item data tableEA_FIN_CM_BOE_SRVBusiness Objects for Bill of Exchange
BOE_DIS_ITEMDiscount item data tableEA_FIN_CM_BOE_SRVBusiness Objects for Bill of Exchange
BOE_DOCBoe DocumentEA_FIN_CM_BOE_SRVBusiness Objects for Bill of Exchange
BOE_END_ITEMEndorse item data tableEA_FIN_CM_BOE_SRVBusiness Objects for Bill of Exchange
BOE_PAY_ITEMPayment item data tableEA_FIN_CM_BOE_SRVBusiness Objects for Bill of Exchange
BOE_PLE_ITEMPledge item data table of BoE managementEA_FIN_CM_BOE_SRVBusiness Objects for Bill of Exchange
BOE_PLE_ITEMPledge item data table of BoE managementEA_FIN_CM_BOE_SRVBusiness Objects for Bill of Exchange
BOE_REF_DOCReference documnet for BoEEA_FIN_CM_BOE_SRVBusiness Objects for Bill of Exchange
EPICT_BRSBank Reconciliation StatementGLO_FIN_EPIC_CNGlobalization Financials E-Payment Integration China
CID_DB_INB_PARMSClearing Partner for PEXR2002ID-FI-EPIC-COPCGlobalization: E-Payment Integration Cash Operation Center
CID_DB_INB_TARGTClearing Partner for PEXR2002ID-FI-EPIC-COPCGlobalization: E-Payment Integration Cash Operation Center
COPC_ACCOUNTCash AccountID-FI-EPIC-COPCGlobalization: E-Payment Integration Cash Operation Center
COPC_ACCT_GROUPCOPC: account group for cash concentrationID-FI-EPIC-COPCGlobalization: E-Payment Integration Cash Operation Center
COPC_CA_ACCClearing Account Determ. for COPC PAYRQ Posting ExampleID-FI-EPIC-COPCGlobalization: E-Payment Integration Cash Operation Center
COPC_RPR_CA_ACCEPIC Cash Application Account ConfigurationID-FI-EPIC-COPCGlobalization: E-Payment Integration Cash Operation Center
EPIC_CBCEPIC:Cash budgeting control consumption tableID-FI-EPIC-PMCTLGlobalization: E-Payment Integration Payment Control
EPIC_CBC_EBRCash Budgeting Control of Bank ReceiptID-FI-EPIC-PMCTLGlobalization: E-Payment Integration Payment Control
EPIC_CB_PLANEPIC: Cash Budgeting planning DB TableID-FI-EPIC-PMCTL-SMPLGlobalization: E-Payment Integration Payment Control Sample
EPIC_DUM_BALBalance of Dummy BankID-FI-EPIC-TESTGlobalization: E-Payment Integration General Test Objects
EPIC_DUM_TRANSACTransactions of Dummy BankID-FI-EPIC-TESTGlobalization: E-Payment Integration General Test Objects
EPIC_EBR_BALBank Account Balance by Bank ReceiptID-FI-EPIC-EBRGlobalization: E-Payment Integration Bank Receipt
IDEU_VATAcquisition TaxID-FIInternational Development: FI-GL/AP/AR
IDTW_VATVAT (Taiwan): Current ValuesID-FIInternational Development: FI-GL/AP/AR
IDUN_C_ASDCAdditional Customizing for ASDCID-FIInternational Development: FI-GL/AP/AR
FIPDCOM_LOGOman PDC Printing logGLO_FIN_FI_OMFI Localization for Private Oman
IDSAU_FSCVALUESForm Structure: ValuesID-FI-SAUFI Localization: Saudi Arabia & United Arab Emirates
IDSAU_FSC_ITEMForm Structure: ItemID-FI-SAUFI Localization: Saudi Arabia & United Arab Emirates
J_1ACI_LIMITLimits for Credit invoiceJ1AFFI Localization (Argentina)
J_1AWTH_TAX_CNTYConditions per Country Code for Applying WithholdingTaxJ1AFFI Localization (Argentina)
J_1AWTH_TAX_COMPConditions per Company Code for Applying WithholdingTaxJ1AFFI Localization (Argentina)
J_1AWTH_TXCNTYNConditions per Country Code for Applying WithholdingTaxJ1AFFI Localization (Argentina)
J_1AWTH_TXCOMPNConditions per Company Code for Applying WithholdingTaxJ1AFFI Localization (Argentina)
/BGLOCS/BNK_DATAHouse bank for print in invoice/BGLOCS/FICEE Financials and Logistics - Bulgaria
/BGLOCS/VATMAHDRVAT Margin Header/BGLOCS/FICEE Financials and Logistics - Bulgaria
/BGLOCS/VATMAITMVAT Margin Items/BGLOCS/FICEE Financials and Logistics - Bulgaria
/CCEE/XXFI_VATDVAT Report C-CEE - Documents processed by RFUMSV00/CCEE/XXLocalization CEE Generic
/TMF/D_CRED_CTRLCredit Control Table/TMF/APP_CREDIT_CTRL_PCOCredit Control for PIS and COFINS on Assets
FIBR_D_CR_CTRL_DI_BR_CREDITCONTROLTP I_BR_CREDITCONTROLTPGLO_FIN_IS_BR_CRED_CTRLCredit Control for PIS and COFINS on Assets
IDCN_3RFF4ADJDOCAdjustment Document HeaderID-FI-CNLocalization (China)
IDCN_ZJFPLBALP&L Balances for Period Account Entry Closing MethodID-FI-CNLocalization (China)
EIV_GTD_HDRGT Document HeaderGLO_FIN_TAX_EINVC_COMMON_CNE-Invoice common
DIAN_A_1001_08Cached Data of DIAN Format 1001 version 08ID-DIAN-CODIAN: Magnetic Meida for Columbia
DIAN_A_1003_07Cached Data of DIAN Format 1003 version 07ID-DIAN-CODIAN: Magnetic Meida for Columbia
DIAN_A_1005_07Cached Data of DIAN Format 1005 version 07ID-DIAN-CODIAN: Magnetic Meida for Columbia
DIAN_A_1006_07Cached Data of DIAN Format 1006 version 07ID-DIAN-CODIAN: Magnetic Meida for Columbia
DIAN_A_1007_08Cached Data of DIAN Format 1007 version 08ID-DIAN-CODIAN: Magnetic Meida for Columbia
DIAN_A_1008_07Cached Data of DIAN Format 1003 version 07ID-DIAN-CODIAN: Magnetic Meida for Columbia
DIAN_A_1009_07Cached Data of DIAN Format 1009 version 07ID-DIAN-CODIAN: Magnetic Meida for Columbia
DIAN_C_FORMATSMaintain DIAN formats configurationID-DIAN-CODIAN: Magnetic Meida for Columbia
/CEECV/BEFI_VATDVAT Report Estonia - document processed from RFUMSV00/CEECV/BEFIEstonia - Financials
J_1GAMASNAsset Super Number Objective ValuesJ1G_AMGreek Localization - FI Asset Legal Books
J_1GVL_WHB010Material Valuation totals per transaction categoryJ1G_WHBGreek Localization - Material valuation / Warehouse book
J_1GVL_WHB011Material valuation pricesJ1G_WHBGreek Localization - Material valuation / Warehouse book
J_1GVL_WHB210Material Valuation totals per transaction categ. (2nd curr.)J1G_WHBGreek Localization - Material valuation / Warehouse book
J_1GVL_WHB211Material valuation prices (2nd curr.)J1G_WHBGreek Localization - Material valuation / Warehouse book
J_1GVL_WHB310Material Valuation totals per transaction categ. (3rd curr.)J1G_WHBGreek Localization - Material valuation / Warehouse book
J_1GVL_WHB311Material valuation prices (3rd curr.)J1G_WHBGreek Localization - Material valuation / Warehouse book
J_1GVL_WHBPOLmaterial analytical ledger period totalsJ1G_WHBGreek Localization - Material valuation / Warehouse book
FIHUC_VATLIMITObsolete - Define VAT limit for HungaryID-FI-HULocalization Hungary
RFCASH_HUExchange rate calculation log (Hungary)ID-FI-HULocalization Hungary
/ATL/GL4Calculation Version/ATL/GSLGeneral ledger
/ATL/KPCC_CURSHVA currency type/ATL/CASHIRcashier system
/ATL/KPFI00005Cashier declared amounts/ATL/CASHIRcashier system
/ATL/KPKP01Chasier connection to sales document/ATL/CASHIRcashier system
/ATL/KPKP01KPChasier connection to sales document - Temporary/ATL/CASHIRcashier system
/ATL/KPKUPECashir openning balance/ATL/CASHIRcashier system
FIWTIN_TAN_EXEMTable for mapping TAN and Exemption NumberJ1ICIN30ADevelopment class for cin30a
J_1IEWTPROVTable for TDS provisionsJ1ICIN30ADevelopment class for cin30a
ISJPINVSUMHDInvoice Summary HeaderID-INVSUM-JPFI Localization Japan: Invoice Summary
ISJPINVSUMITLine items for invoice summaryID-INVSUM-JPFI Localization Japan: Invoice Summary
ISJPPATTERNBank charge patternID-INVSUM-JPFI Localization Japan: Invoice Summary
FOT_TDT_T042JBank charges determination for TDTGLO_FIN_JPGlobalization Financials Japan
GLO_JP_TAXRESULTJapan Tax Reallocation ResultsGLO_FIN_JP_TAX_REALLOCJapan: Tax Re-Allocation
IDKR_NDEDVATITMDSouth Korea Non-Deductible Input VAT Item DetailsGLO_FIN_NON_DEDUCTIBLE_VATManage Non-Deductible Input VAT - South Korea
IDKR_RPTDVATITMDSouth Korea Reported Non-Deductible Input VAT Item DetailsGLO_FIN_NON_DEDUCTIBLE_VATManage Non-Deductible Input VAT - South Korea
FIPDCKW_CHECKREPCheck repository (Kuwait)GLO_FIN_FI_KWFI Localization for Private Kuwait
FITDKWC_LOSSLosses Carried Forward for Tax DeclarationGLO_FIN_FI_KWFI Localization for Private Kuwait
FITDKWC_TXRATESTax ratesGLO_FIN_FI_KWFI Localization for Private Kuwait
FITDKW_FSCVALUESForm Structure: ValuesGLO_FIN_FI_KWFI Localization for Private Kuwait
FITDKW_FSC_ITEMForm Structure: ItemGLO_FIN_FI_KWFI Localization for Private Kuwait
FIKZD_TRTAXTransport tax KazakstanGLO_FIN_FI_KZDevelopments for Kazakhstan
/CEECV/BVFI_CURROfficial Currency for Country/CEECV/BVFILatvia - Financials
/CEECV/BVFI_PVNDocuments for VAT Declaration/CEECV/BVFILatvia - Financials
SND_NO_FI_HSAF-T NO : Header of FI documentsID-SAFT-NOSAF-T Norway
SND_PL_FA_HSAF-T PL : FA HeaderID-SAFT-PLSAF-T Poland
SND_PL_FA_ISAF-T PL : FA ItemID-SAFT-PLSAF-T Poland
SND_PL_KR_ISAF-T PL : KR ItemsID-SAFT-PLSAF-T Poland
SND_PL_MAGSAF-T PL : Material Document Movements for JPK_MAGID-SAFT-PLSAF-T Poland
SND_PL_VATSAF-T PL : VATID-SAFT-PLSAF-T Poland
SND_PL_VAT_DECLSAF-T PL: VAT Declaration Fields ValuesID-SAFT-PLSAF-T Poland
FIAPPTD_BALANCETable to store the Balances for Vendor/Customer/Bank AccountID-FI-PTAdd-On Development - FI - Portugal
FIAPPTD_TRANSTable to store the transaction details of the CBR PTID-FI-PTAdd-On Development - FI - Portugal
SAFT_PT_TAX_DATA Tax Details for SAFT-PTID-FI-PTAdd-On Development - FI - Portugal
FIGNC_CONSVALConstants for Finance - MENAGLO_FIN_FI_QADevelopments for Qatar
FITDQAC_FSCVALUEForm Structure: ValuesGLO_FIN_FI_QADevelopments for Qatar
/CEECV/ROFIUMSVTax Balances per Comp.Code, Tax Code and Process.Key/CEECV/ROFIRomania development class - FI
/CEECV/ROFI_SPHBRO VAT Split - Define VAT House banks for currency/CEECV/ROFIRomania development class - FI
/CEECV/ROFI_SPVNRO VAT Split - Define VAT Split item attributes/CEECV/ROFIRomania development class - FI
/CEECV/RORFMDATARO RFUMSV00 official run data/CEECV/ROFIRomania development class - FI
/CEECV/RO_KNC1FCustomer master (transaction figures in foreign currency)/CEECV/ROFIRomania development class - FI
/CEECV/TRVORControl Statements with BA/CEECV/ROFIRomania development class - FI
J3RF_VATCRQ12Section 12 (173.5)J3RFLocalization Russia: FI
J3RF_VATCRQ8Section 8 (Purchase book)J3RFLocalization Russia: FI
J3RF_VATCRQ_BRKVAT Clarification request - Broker dataJ3RFLocalization Russia: FI
J3RF_VATCRQ_UNC2VATCRQ - Unconfirmed records (Invoice data)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RBUE_BK_TABLETransparent table for PurBook (ALV)J3RFLocalization Russia: FI
J_3RDOPDEBSecondary index table for VATJ3RFLocalization Russia: FI
J_3RFGTD_HEADERImport Customs Declaration HeaderJ3RFLocalization Russia: FI
J_3RFIN_RATE_CLCDownpayments rate calculator for foreign currency - invoicesJ3RFLocalization Russia: FI
J_3RFTAX_EXTRDTax Extract Detail LinesJ3RFTAXTax Accounting
J_3RF_BK_TOTALSIncoming Totals for Add. Sheets of Sales/ Purchase LedgersJ3RFLocalization Russia: FI
J_3RF_BK_TOTALSQIncoming Totals for Add. Sheets of S/ P Ledgers by QartersJ3RFLocalization Russia: FI
J_3RF_CPS_RULESCustomer Payment Solution: Sales Order Unblock RulesJ3RFLocalization Russia: FI
J_3RF_CTS_ICurrency Transaction Statement Document ItemsJ3RFLocalization Russia: FI
J_3RF_CTS_ICurrency Transaction Statement Document ItemsJ3RFLocalization Russia: FI
J_3RF_REGINV_DEOutgoing invoice journal transp tab for IBOOK ver 2J3RFLocalization Russia: FI
J_3RF_REGINV_DEOutgoing invoice journal transp tab for IBOOK ver 2J3RFLocalization Russia: FI
J_3RF_REGINV_DEOutgoing invoice journal transp tab for IBOOK ver 2J3RFLocalization Russia: FI
J_3RF_REGINV_DEOutgoing invoice journal transp tab for IBOOK ver 2J3RFLocalization Russia: FI
J_3RF_REGINV_INIncoming Invoice Registration JournalJ3RFLocalization Russia: FI
J_3RF_REGINV_INIIncoming Invoice ItemJ3RFLocalization Russia: FI
J_3RF_REGINV_KIncoming invoice journal transp tab for IBOOKJ3RFLocalization Russia: FI
J_3RF_REGINV_KIncoming invoice journal transp tab for IBOOKJ3RFLocalization Russia: FI
J_3RF_REGINV_OUTOutgoing Invoice Registration JournalJ3RFLocalization Russia: FI
J_3RF_REGOUTINInv. Journal: Links between outgoing and incoming invoicesJ3RFLocalization Russia: FI
J_3RF_RGTORG_INIncoming Journal of Acceptance DocumentsJ3RFLocalization Russia: FI
J_3RF_RGTORG_INIIncoming Invoice ItemJ3RFLocalization Russia: FI
J_3RF_RGTORG_OUTOutgoing Journal of Acceptance DocumentsJ3RFLocalization Russia: FI
J_3RF_TP_CP_SHDRControllable Partners. Head Data saved in backgroudJ3RFLocalization Russia: FI
J_3RF_TP_CP_SHDRControllable Partners. Head Data saved in backgroudJ3RFLocalization Russia: FI
J_3RF_TP_PRICESIntervals of Market Prices of Controlled TransactionsJ3RFLocalization Russia: FI
J_3RF_VATX_TOTALVAT Ledgers books totalsJ3RFLocalization Russia: FI
J_3RKKR0Account correspondence - summary tableJ3RKAccount Correspondence Subsystem (Russia)
J_3RKKRSAccount correspondence line itemsJ3RKAccount Correspondence Subsystem (Russia)
J_3RK_CORR_ITEMSAccount correspondence line itemsJ3RKAccount Correspondence Subsystem (Russia)
J_3RNDSINVTarget use of ingoing invoice positions for AuCJ3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RSL_BK_TABLETransparent table for SaleBook (ALV)J3RFLocalization Russia: FI
J_3RTSESecondary index table for VATJ3RFLocalization Russia: FI
J_3RTTAXADVPMNTSAdvanced payments for russian transport taxJ3RALFLocalization Russia - Legal Forms
J_3RTTAXPLATON"Platon" payments per vehicleJ3RALFLocalization Russia - Legal Forms
J_3RUMSVTax Balances per Comp.Code, Tax Code and Process.Key+ clientJ3RFLocalization Russia: FI
J_3RVATD_RUNStored VAT-return Runs: Main SectionJ3RFLocalization Russia: FI
J_3RVATD_RUN_TAStored VAT-return Runs: Tax Agent SectionJ3RFLocalization Russia: FI
J_3R_CADASTR_VALCadastral Values DataJ3RFLocalization Russia: FI
J_3R_FATAXTransport Tax DataJ3RALFLocalization Russia - Legal Forms
J_3R_INVDIFFOffsetting inventory differences of goodsJ3RALFLocalization Russia - Legal Forms
J_3R_PTAX_ABROADTax Paid Abroad Property taxJ3RALFLocalization Russia - Legal Forms
J_3R_SO_PAYMENTSAssignment of Payments to Sales OrdersJ3RFLocalization Russia: FI
J_3R_SO_PAYMENTSAssignment of Payments to Sales OrdersJ3RFLocalization Russia: FI
J_3R_SO_PAYMENTSAssignment of Payments to Sales OrdersJ3RFLocalization Russia: FI
FIRUD_FSTM_ACCTBACR Financial Statement Russia Accounting Balance Log TableGLO_FIN_RUGlobalization Financials Russia
FIRUD_FSTM_RPICFACR Cash Flow Statement Russia Reported Item Log TableGLO_FIN_RUGlobalization Financials Russia
FIRUD_FSTM_RPITMACR Financial Statement Russia Reported Item Log TableGLO_FIN_RUGlobalization Financials Russia
FIRUD_FSTM_SMVALACR Stock Valuation Russia Log Table - Material ValuationGLO_FIN_RUGlobalization Financials Russia
FIRUD_FSTM_S_BSVACR Stock Valuation Russia Log Table - Balance Sheet Val.GLO_FIN_RUGlobalization Financials Russia
FIRUD_FSTM_S_FIACR Stock Valuation Russia Log Table - FI revaluationGLO_FIN_RUGlobalization Financials Russia
FIRUD_FSTM_S_MMACR Stock Valuation Russia Log Table - Material DocumentsGLO_FIN_RUGlobalization Financials Russia
FIRUD_TROP_RPITMACR Log Table for Traceability OperationsGLO_FIN_RUGlobalization Financials Russia
FIRUD_VAT1_RPITMVAT Reporting Items Log TableGLO_FIN_RUGlobalization Financials Russia
FIRU_RECON_REPReconciliation Report HeaderGLO_FIN_CISGlobalization Financials CIS (translation to RU, UA and KZ)
FIBKRUD_BALANCEFI Banking Russia: Totals RecordsGLO_FIN_FIBK_RUDevelopment for ERP Banking Russia
FIRUD_IMCD_ITM_DI_RU_IMPRTCSTMSDECLNITEMTP I_RU_IMPRTCSTMSDECLNITEMTPGLO_FIN_IS_RU_FOREIGN_TRADEInformation System: Russia import/export operations
/CCEE/SIFIPE17Temporary import of goods/CCEE/SIFICEE Financials and Logistics - Slovenia
/CCEE/SIFISTATE2Balances on accounts for SFR report/CCEE/SIFICEE Financials and Logistics - Slovenia
/CCEE/SIFISTATESBalances on accounts for SFR report/CCEE/SIFICEE Financials and Logistics - Slovenia
/CCEE/SIFI_UMSITTax items applied for decrease/increase of input VAT/CCEE/SIFICEE Financials and Logistics - Slovenia
FIAPSK_EOBDefinition of external operations - obsoleteID-FI-SKFI Localization (Slovakia)
FISKC_PRTYPETax Classification of the Product TypeID-FI-SKFI Localization (Slovakia)
FISKD_SUMMARYVAT Ledger Summarized ItemsID-FI-SKFI Localization (Slovakia)
FISKD_VATCNTRLVAT Ledger ItemsID-FI-SKFI Localization (Slovakia)
RFUMSV00_HISTMaintain data for previous VAT return runID-FI-SKFI Localization (Slovakia)
FISKVATC_ITMVAT Control Statement ItemsGLO_FIN_IS_VAT_SKGlob. Financials Information System VAT Slovakia
FISK_RET_HISTVAT Declaration SummaryGLO_FIN_IS_VAT_SKGlob. Financials Information System VAT Slovakia
FITRC_LIMITTurkey: Threshold limit for Ba/Bs reportingID-FI-TRTurkey
J_1UF_CURR_CONVCurrency convertion documentsJ1UFLocalization Ukraine: FI
J_1UF_INV_REFDocument references to FI Invoice processed itemsJ1UFLocalization Ukraine: FI
J_1UF_INV_REF_LDocument references to FI Invoice processed itemsJ1UFLocalization Ukraine: FI
J_1UF_MKTPRPOSTax Invoice Positions with Market PricesJ1UFLocalization Ukraine: FI
J_1UF_ORD_IN_TAXOrder data used in tax vouchers and correctionsJ1UFLocalization Ukraine: FI
J_1UF_TAXPOS_FIReference from TI/CTI positions to source FI positionsJ1UFLocalization Ukraine: FI
J_1UF_TAXPOS_TIReference from CTI positions to TI positionsJ1UFLocalization Ukraine: FI
J_1UF_TP_ANNEXT2Annex TP: Table 2J1UFLocalization Ukraine: FI
J_1UF_TP_MAINMain Information of NotificationJ1UFLocalization Ukraine: FI
J_1UF_TP_PRICESIntervals of Market Prices of Controlled TransactionsJ1UFLocalization Ukraine: FI
J_1UF_TP_RESGRPInformation of Notification. GroupingJ1UFLocalization Ukraine: FI
J_1UF_TP_RESOPRInformation of Notification. OperationsJ1UFLocalization Ukraine: FI
J_1UF_TP_RESOPRInformation of Notification. OperationsJ1UFLocalization Ukraine: FI
J_1USEXTRACTDExtract dataJ1USCountry-specific functions for Ukraine (SD, MM)
J_1USEXTRACTDExtract dataJ1USCountry-specific functions for Ukraine (SD, MM)
J_1USEXTRACTDExtract dataJ1USCountry-specific functions for Ukraine (SD, MM)
J_1USEXTRACTDExtract dataJ1USCountry-specific functions for Ukraine (SD, MM)
J_1USEXTRACTDExtract dataJ1USCountry-specific functions for Ukraine (SD, MM)
J_1USEXTRACTDExtract dataJ1USCountry-specific functions for Ukraine (SD, MM)
J_1USEXTRACTDExtract dataJ1USCountry-specific functions for Ukraine (SD, MM)
J_1USEXTRACTDExtract dataJ1USCountry-specific functions for Ukraine (SD, MM)
J_1USEXTRACTD_MMExtract dataJ1USCountry-specific functions for Ukraine (SD, MM)
J_1USEXTRACTD_MMExtract dataJ1USCountry-specific functions for Ukraine (SD, MM)
J_1USEXTRACTD_MMExtract dataJ1USCountry-specific functions for Ukraine (SD, MM)
J_1USEXTRACTD_MMExtract dataJ1USCountry-specific functions for Ukraine (SD, MM)
J_1USEXTRACTD_MMExtract dataJ1USCountry-specific functions for Ukraine (SD, MM)
J_1USEXTRACTD_MMExtract dataJ1USCountry-specific functions for Ukraine (SD, MM)
IDREPFW_REPGR_CRep.Framework: Report GroupID-REP_FRWKInternational Development: Reporting Framework
IDREPFW_REPID_CRep.Framework: Report IdentificationID-REP_FRWKInternational Development: Reporting Framework
IDREPFW_REPVR_CRep.Framework: Report VersionID-REP_FRWKInternational Development: Reporting Framework
IDREPFW_STORPRep.Framework: Data Storage - Sections of ReportID-REP_FRWKInternational Development: Reporting Framework
CADE_EACCTGBKChina audit electronic accounting bookGLO_FIN_CADE_CNGlobalization Financials China Audit Data Extraction
CADE_GENERALCADE General Master TableODATA_FICN_CADE_GA_BAS_CONFODATA for Report Configuration of China Audit Data Exaction
IDCN_FSCVALUESForm Structure: ValuesID-FI-CN-SAUFI Localization: China, Saudi Arabia, United Arab Emirates
IDCN_FSC_ITEMForm Structure: ItemID-FI-CN-SAUFI Localization: China, Saudi Arabia, United Arab Emirates
FIAU_SUP_AMT_LOGAU TPAR Supplier and its corresponding Amount LogGLO_FIN_IS_AUGlobalization Financials Information System Australia
IDGT_CONF_LCGTI China: Tax Invoice tableID-SD-CN-GTGolden Tax interface China
IDGT_GTDHGT Document HeaderID-SD-CN-GT-01Golden Tax Interface Enhancements
IDGT_INFOGTI China: Data sent to GTID-SD-CN-GTGolden Tax interface China
IDGT_VATHVAT Invoice HeaderID-SD-CN-GT-01Golden Tax Interface Enhancements
FIEUD_GOODS_ISAFT-XML:Goods Movement Line ItemsID-LO-LULocalization Luxembourg
FIEUD_MMINV_HSAFT:MM: Header table for XML Purchase InvoiceID-LO-LULocalization Luxembourg
FIEUD_MMINV_ISAFT:MM: Item Details for XML Purchase InvoiceID-LO-LULocalization Luxembourg
J_1AIMMLEGACYLegacy data - INMA-MMJ1AILOGExtended Inflation (LO)
FIWTBRC_TDS_THRStore daily threshold amount for Brazil withholding taxJ1BALocalization Brazil
J_1BNFEPARKLINNota fiscal electronica: Invoice create failedJ1BALocalization Brazil
J_1BPOSCOUPONSPOS-Database Coupons (Brazilian)J1BALocalization Brazil
J_1BPOSREDUCTIONPOS-Database Reduction (Brazilian)J1BALocalization Brazil
J_1BTXCOFTax Calculation: COFINSJ1BALocalization Brazil
J_1BTXIP1Tax calc.: IPI rulesJ1BALocalization Brazil
J_1BTXIP2Tax calc.: IPI rules (material dependent)J1BALocalization Brazil
J_1BTXIP3Grouped IPIJ1BALocalization Brazil
J_1BTXISSTax Calculation: ISSJ1BALocalization Brazil
J_1BTXPISTax Calculation: PISJ1BALocalization Brazil
J_1BTXST1Tax calc.: Sub.Trib. rulesJ1BALocalization Brazil
J_1BTXST2Tax calc.: Sub.Trib. rules (general)J1BALocalization Brazil
J_1BTXST3Dynamic Calculation of Substitui��o Tribut�riaJ1BALocalization Brazil
J_1IG_GST_JVGST Journal Voucher Posting DetailsJ1I_GST_LOGST India (Logistics)
J_1IG_ISD_DISTRGST IN: ISD Distribution DetailsJ1I_GST_LOGST India (Logistics)
J_1IG_ISD_TOGST IN: Receiving BUPLA TurnoverJ1I_GST_LOGST India (Logistics)
J_1IG_ISD_TONGST IN: Receiving BUPLA TurnoverJ1I_GST_LOGST India (Logistics)
J_1ISERVCService tax detailsJ1I3India, Phase II
J_1ISER_BSEGTransaction table having the Invoices with Service CategoryJ1I2India, Phase II
/SAPNEA/JSCCHHI[SC] Chargeable <-> Nonchargeable changing history/SAPNEA/J_SC1_TABLESSubcontracting Management Tables
/SAPNEA/ROWAChargeable component consumptions/SAPNEA/J_SC1_TABLESSubcontracting Management Tables
/SAPNEA/ROWAChargeable component consumptions/SAPNEA/J_SC1_TABLESSubcontracting Management Tables
SCON_JP_POVALDTNSubcontracting Purchase Order Item Validation for JapanSUBCON_JSUGSubcontracting Management for Japan Sap User Group
J_3RJ_CURR_CONVCurrency conversion for Russia specificJ3RMLocalization Russia: MM
J_3RJ_CURR_TCurrency conversion TextJ3RMLocalization Russia: MM
J_3RM_RN_DOCTraceability: RN Movement DocumentsJ3RMLocalization Russia: MM
PAYTADOC_DRAFTI_PAYMENTRECEIPTTP I_PAYMENTRECEIPTRELATEDDOCTPGLO_FIN_PAYMENT_RECEIPTGlobalization Financials Payment Receipt
PAYTDETS_DRI_PAYMENTRECEIPTTP I_PAYMENTRECEIPTPAYTDETAILTPGLO_FIN_PAYMENT_RECEIPTGlobalization Financials Payment Receipt
PAYTRCPT_DRAFTI_PAYMENTRECEIPTTP I_PAYMENTRECEIPTTPGLO_FIN_PAYMENT_RECEIPTGlobalization Financials Payment Receipt
PAYTRCPT_PAYTDETPayment Receipt Payment DetailGLO_FIN_PAYMENT_RECEIPTGlobalization Financials Payment Receipt
FIEUD_FIDOC_HSAFT: FI Transaction Document HeaderID-FI-SAFTSAF-T Reporting (generic parts)
FIEUD_FIDOC_ISAFT: FI Transaction Document ItemID-FI-SAFTSAF-T Reporting (generic parts)
FIEUD_FIDOC_ISAFT: FI Transaction Document ItemID-FI-SAFTSAF-T Reporting (generic parts)
FIEUD_FIDOC_ISAFT: FI Transaction Document ItemID-FI-SAFTSAF-T Reporting (generic parts)
FIEUD_FISUMMARYSAFT: FI Transaction Summary InformationID-FI-SAFTSAF-T Reporting (generic parts)
FIEUD_INVSUMMARYSAFT: FI Transaction Summary InformationID-FI-SAFTSAF-T Reporting (generic parts)
FIEUD_SBINV_HSAFT: Self Billing Invoices (Header)- (MM)ID-FI-SAFTSAF-T Reporting (generic parts)
FIEUD_SBINV_ISAFT: Self Billing Invoices ( Line Items)ID-FI-SAFTSAF-T Reporting (generic parts)
FIEUD_SBINV_ISAFT: Self Billing Invoices ( Line Items)ID-FI-SAFTSAF-T Reporting (generic parts)
FIEUD_SBINV_ISAFT: Self Billing Invoices ( Line Items)ID-FI-SAFTSAF-T Reporting (generic parts)
FIEUD_SBINV_ISAFT: Self Billing Invoices ( Line Items)ID-FI-SAFTSAF-T Reporting (generic parts)
FIEUD_SB_SUMMARYSAFT: Self Billing Extraction SummaryID-FI-SAFTSAF-T Reporting (generic parts)
FIEUD_SDINV_HSAFT: Invoices from SD module(Header)ID-FI-SAFTSAF-T Reporting (generic parts)
FIEUD_SDINV_ISAFT: Invoices from SD module(Item)ID-FI-SAFTSAF-T Reporting (generic parts)
FIEUD_SDINV_ISAFT: Invoices from SD module(Item)ID-FI-SAFTSAF-T Reporting (generic parts)
FIEUD_SDINV_ISAFT: Invoices from SD module(Item)ID-FI-SAFTSAF-T Reporting (generic parts)
FIEUD_SDINV_ISAFT: Invoices from SD module(Item)ID-FI-SAFTSAF-T Reporting (generic parts)
FIEU_PAY_INFOSAFT: Table to store Payment InformationID-FI-SAFTSAF-T Reporting (generic parts)
SAFTND_EXT_SUMSAF-T Extraction SummaryID-SAFT-XXSAF-T Framework Cross Component
SND_AO_CI_HSAF-T AO CI HeaderID-SAFT-AO-CISAF-T Angola Convergent Invoicing
FIPLD_BANK_HSAFT PL: Bank reporting HeaderID-FI-PL-SAFTSAFT Poland
FIPLD_BANK_SSAFT PL: Bank statement headerID-FI-PL-SAFTSAFT Poland
FIPLD_FIDOC_HSAFT: FI Transaction Document HeaderID-FI-PL-SAFTSAFT Poland
FIPLD_GOODS_ISAFT PL:Goods Movement Line ItemsID-FI-PL-SAFTSAFT Poland
FIPLD_INVSUMCURRSAF-T PL: Invoice Summary Information by CurrencyID-FI-PL-SAFTSAFT Poland
FIPLD_INVSUMMARYSAF-T PL: Invioce Summary InformationID-FI-PL-SAFTSAFT Poland
FIPLD_MMINV_HSAFT:MM: Header table for XML Purchase InvoiceID-FI-PL-SAFTSAFT Poland
FIPLD_MMINV_ISAFT:MM: Item Details for XML Purchase InvoiceID-FI-PL-SAFTSAFT Poland
FIPLD_PAY_INFOSAFT: Table to store Payment InformationID-FI-PL-SAFTSAFT Poland
FIPLD_SDDP_SO_ISAFT: Down payment data for invoices from SDID-FI-PL-SAFTSAFT Poland
FIPLD_SDINV_HSAFT: Invoices from SD/FI module (Header)ID-FI-PL-SAFTSAFT Poland
FIPLD_TAX_DATATax Details for SAFT-PLID-FI-PL-SAFTSAFT Poland
FIPLD_VAT_HVAT header extractor - SAFT-PLID-FI-PL-SAFTSAFT Poland
J_3RSCCDHEADERExport GTD HeaderJ3RSLocalization Russia: SD
J_3RSCCDITEMExport GTD ItemJ3RSLocalization Russia: SD
J_3RSEXTRACTDExctract details (obsolete)J3RSLocalization Russia: SD
J_3RSEXTRACTDExctract details (obsolete)J3RSLocalization Russia: SD
J_3RSEXTRACTDExctract details (obsolete)J3RSLocalization Russia: SD
J_3RSEXTRACTDExctract details (obsolete)J3RSLocalization Russia: SD
J_3RSEXTRACTDExctract details (obsolete)J3RSLocalization Russia: SD
J_3RSEXTRACTDExctract details (obsolete)J3RSLocalization Russia: SD
J_3RSEXTRACTDExctract details (obsolete)J3RSLocalization Russia: SD
J_3RSEXTRACTDExctract details (obsolete)J3RSLocalization Russia: SD
J_3RSPASSDEALDeal PassportJ3RSLocalization Russia: SD
TXI_HDRChina Tax Invoice HeaderGLO_FIN_TAX_COMM_CNGlobalization Financials China Tax Common Objects
TXI_DECLNSMMRYCN Tax Declaration SummaryGLO_FIN_TAX_INPUT_DECLN_MGMTChina Input Tax Declaration Management
TXI_HDRTPI_CN_TAXINPUTINVCTP I_CN_TAXINPUTINVCTPGLO_FIN_TAX_INVC_MGMT_COMM_CNCommon objects such as DDIC
TXI_ITMTPI_CN_TAXINPUTINVCTP I_CN_TAXINPUTINVOICEITEMTPGLO_FIN_TAX_INVC_MGMT_COMM_CNCommon objects such as DDIC
IDCFMFLCALCRLADescription of simplified flow calc.procedure (amounts)ID-CFMTreasury/CFM Localization Development Class
IDCFMFLCALCRLPDescription of simplified flow calc.procedure (percentages)ID-CFMTreasury/CFM Localization Development Class
IDCFM_TRANSFUNDSFunds: Additional InformationsID-CFMTreasury/CFM Localization Development Class
IDCFMHU_ASLOGLOG installments repayment sec. depreciationID-CFM-HU-MMTreasury Localization: Money Market
IDCFMHU_CREPO_CAssign G/L Accounts for Repo Off-Balance PostingsID-CFM-HU-MMTreasury Localization: Money Market
IDCFM_USFX_UT_CUCustomizing FX Average Rate: CurrenciesID-CFM-US-FAMATreasury Localization USA: FAM
IDCMLHU_13ODLGOpen Debt Log Pass on TableID-CML-HULoans Localization Hungary
IDCMLHU_13PDLGSuspended Commitment and Interest Posting LogID-CML-HULoans Localization Hungary
IDCMLHU_14PSTPOSInterest on Arrears Posting Document ItemID-CML-HULoans Localization Hungary
EXT_RECON_ITEMSReconciliation Document Line ItemGLO_FIN_EXT_RECON_APPLGlobalization Financials External Reconciliation Application
FARR_C_DET_SSPRevenue Accounting: Derive Standalone Selling PriceFARR_FOUNDATIONRevenue Accounting: Reuse Objects
FARR_C_POB_TYPEConfiguration of Performance Obligation TypesFARR_FOUNDATIONRevenue Accounting: Reuse Objects
FARR_D_BIZ_RECONBusiness Reconciliation TableFARR_CONS_CHECKConsistency Check Framework
FARR_D_CATCHUPRevenue Catch-upFARR_CDS_ANALYTICSRevenue Accounting: CDS based Analytics
FARR_D_CONSRA - consistency check / contract dataFARR_CONS_CHECKConsistency Check Framework
FARR_D_LEGACYLegacy data for initial load of revenue accounting itemsFARRAD_FOUNDATIONRevenue Accounting: Adapter Reuse Layer
FARR_D_LEGACYCLegacy data for initial load of conditions for rev.acc.it.FARRAD_FOUNDATIONRevenue Accounting: Adapter Reuse Layer
FARR_D_LEGACYSFlegacy data for scheduled fulfillments (time based)FARRAD_FOUNDATIONRevenue Accounting: Adapter Reuse Layer
FARR_D_POB_CTYPEPerformance Obligation Change TypeFARR_PERSISTENCYPersistency Layer
FARR_D_POB_CTYPEPerformance Obligation Change TypeFARR_PERSISTENCYPersistency Layer
FARR_D_POSTING_PPostponed PostingsFARR_PERSISTENCYPersistency Layer
FARR_D_CHG_TYPETable of Change TypeFARR_CONTRACT_DBRevenue Accounting: Contract Management Persistence
FARR_D_COMP_TRANResult table of comparative reportFARR_CONTRACT_DBRevenue Accounting: Contract Management Persistence
FARR_D_CONTRACTContractsFARR_CONTRACT_DBRevenue Accounting: Contract Management Persistence
FARR_D_CONTR_DDraft Table for Revenue Accounting ContractFARR_CONTRACT_RAPRevenue Accounting Contract RAP Model
FARR_D_DEFITEMDeferral ItemsFARR_CONTRACT_DBRevenue Accounting: Contract Management Persistence
FARR_D_FULFILLMTFulfillmentsFARR_CONTRACT_DBRevenue Accounting: Contract Management Persistence
FARR_D_FX2_EXPLData for revenue exchange rate explanationFARR_CONTRACT_DBRevenue Accounting: Contract Management Persistence
FARR_D_INVOICEInvoice EntriesFARR_CONTRACT_DBRevenue Accounting: Contract Management Persistence
FARR_D_INV_FX_EDDistributed invoice & exchange rate differenceFARR_CONTRACT_DBRevenue Accounting: Contract Management Persistence
FARR_D_POBPerformance ObligationsFARR_CONTRACT_DBRevenue Accounting: Contract Management Persistence
FARR_D_POBPerformance ObligationsFARR_CONTRACT_DBRevenue Accounting: Contract Management Persistence
FARR_D_POB_CORRTCorrect Performance Obligations before Contract turns to ErrFARR_CONTRACT_DBRevenue Accounting: Contract Management Persistence
FARR_D_POB_CORRTCorrect Performance Obligations before Contract turns to ErrFARR_CONTRACT_DBRevenue Accounting: Contract Management Persistence
FARR_D_POB_DDraft Table for RA Performance ObligationFARR_CONTRACT_RAPRevenue Accounting Contract RAP Model
FARR_D_POSTINGPostingsFARR_CONTRACT_DBRevenue Accounting: Contract Management Persistence
FARR_D_POSTING_SPostings (Shadow Table)FARR_CONTRACT_DBRevenue Accounting: Contract Management Persistence
FARR_D_COST_COProcessed Cost RAIs - Condition ItemsFARR_INBOUND_DBRevenue Accounting Inbound Processing - DB layer
FARR_D_COST_MIProcessed Cost RAIs - Main ItemsFARR_INBOUND_DBRevenue Accounting Inbound Processing - DB layer
FARR_D_FLFMT_MIProcessed Fulfillment RAIs - Main ItemsFARR_INBOUND_DBRevenue Accounting Inbound Processing - DB layer
FARR_D_INB_COPostponed RAIs - Condition ItemsFARR_INBOUND_DBRevenue Accounting Inbound Processing - DB layer
FARR_D_INB_MIPostponed RAIs - Main ItemsFARR_INBOUND_DBRevenue Accounting Inbound Processing - DB layer
FARR_D_INV_COProcessed Invoice RAIs - Condition ItemsFARR_INBOUND_DBRevenue Accounting Inbound Processing - DB layer
FARR_D_INV_MIProcessed Invoice RAIs - Main ItemsFARR_INBOUND_DBRevenue Accounting Inbound Processing - DB layer
FARR_D_ORD_COProcessed Order RAIs - Condition ItemsFARR_INBOUND_DBRevenue Accounting Inbound Processing - DB layer
FARR_D_ORD_MIProcessed Order RAIs - Main ItemsFARR_INBOUND_DBRevenue Accounting Inbound Processing - DB layer
IRACONTRWP_DI_RACONTRWITHPOSTEDBALANCETP I_RACONTRWITHPOSTEDBALANCETPODATA_FARR_CONTRACT_OVERVIEWOdata Service:POB structure
IRAPOBWAMT_DI_RACONTRWITHPOSTEDBALANCETP I_RAPERFOBLGNWTHTOCURPERDAMTTPODATA_FARR_CONTRACT_OVERVIEWOdata Service:POB structure
RAAGGRGDFLFMT_DI_RAMANUALFULFILLMENTTP I_RAPERFOBLGNAGGRGDFLFMTTPODATA_FARR_MANUALFULFILLMENTOdata Service: manual fulfillment
RACONFLICTATTR_DI_RACONFLICTEDCONTRWORKLISTTP I_RACONFLICTEDATTRIBWORKLISTTPODATA_FARR_CONTRACT_WORKLISTApp: Worklist for Contracts with Conflicts
RACONFLICTCONT_DI_RACONFLICTEDCONTRWORKLISTTP I_RACONFLICTEDCONTRWORKLISTTPODATA_FARR_CONTRACT_WORKLISTApp: Worklist for Contracts with Conflicts
RAMNLFLFMTTP_DI_RAMANUALFULFILLMENTTP I_RAMANUALFULFILLMENTTPODATA_FARR_MANUALFULFILLMENTOdata Service: manual fulfillment
T800SFI-SL Set Table (before Release 4.0)GBSEFI-SL sets
FINSUBVALCOBLMetadata Container for FIN Rule engineFINS_GEN_SUB_VALSubstitution and Validation
FINSUBVALCOBLPSMMetadata Container for FIN Rule engine - Public Sector ManagFINS_GEN_SUB_VALSubstitution and Validation
ICA_RECONBAL_GTTReconcialiation Balance Global Temporary TableFIN_ICA_RECONInter-Company Reconciliation
FDMO_INV_DUMMYOData Process Receivables - Dummy for InvoicesODATA_CUSTOMER_RECEIVABLESOData Services - Process Receivables
FDMO_INV_DUMMYOData Process Receivables - Dummy for InvoicesODATA_CUSTOMER_RECEIVABLESOData Services - Process Receivables
UKM_TOTALS_SRCLiability Totals - With Original Data Source Partner/SegmentODATA_CREDIT_MGMT_EXPOSUREOData-Service: Credit Management Exposure
UKM_TOTALS_SRCLiability Totals - With Original Data Source Partner/SegmentODATA_CREDIT_MGMT_EXPOSUREOData-Service: Credit Management Exposure
IMBKWITHTMPLDFI_MAKEBANKTRANSFERTEMPLATETP I_MAKEBANKTRANSFERTEMPLATETPODATA_BANKTRANSFERoData for Bank Transfer
IMBTMPLITMTI_MAKEBKTRANSFWITHTMPLTP I_MAKEBKTRANSFWTHTMPLITMTPODATA_BANKTRANSFERoData for Bank Transfer
IMBTTMPLITMTI_MAKEBKTRANSWITHTMPLTP I_MAKEBKTRANSFWTHTMPITMTPODATA_BANKTRANSFERoData for Bank Transfer
IHC_PI_INB_PARMSPI: Clearing Partner Posting ParametersIHC_PIIDoc (PAYEXT Inbound) Interface
IHC_PI_INB_TARGTPI: Payment Parameters for Inbound IDOCIHC_PIIDoc (PAYEXT Inbound) Interface
EBPP_ORDER_PAYPayment Orders via Biller Direct: Payment DataEBPP_APAR
EBPP_SCHD_DISPPayment scheduling disputeEBPP_APAR_FIORIEBPP_APAR for Fiori
EBPP_SCHD_HDRPayment scheduling headerEBPP_APAR_FIORIEBPP_APAR for Fiori
EBPP_SCHD_PAYITPayment scheduling payment itemEBPP_APAR_FIORIEBPP_APAR for Fiori
T042ICCAccount Determination Payment Cards in Payment ProgramEBPP_APAR
T042IPSPAccount Determination External Payments for Payment ProgramEBPP_APAR
FCLM_CPL_FLOW_ITLine item for cash poolingFCLM_CASHPOOLINGFor cash pooling
FCLM_FB2_FLOWFlow Builder 2: Flows in ProcessFCLM_REUSECommon / Reusable Components
FCLM_FB2_OFFSETFlow Builder 2: Offset DocumentsFCLM_REUSECommon / Reusable Components
FCLM_FB_BKPF_UTFlow Builder unit test - simulate BKPF tableFCLM_REUSECommon / Reusable Components
FCLM_FB_BRICKFlow Builder: BricksFCLM_REUSECommon / Reusable Components
FCLM_FB_BRICK2Flow Builder: BricksFCLM_REUSECommon / Reusable Components
FCLM_FB_BSEG_UTFlow Builder unit test - simulate BSEG tableFCLM_REUSECommon / Reusable Components
FCLM_FB_CONNFlow BuilderFCLM_REUSECommon / Reusable Components
FCLM_FB_CONN_NEGFlow Builder Connector - support negative connectorsFCLM_REUSECommon / Reusable Components
FCLM_FB_FLOWFlow Builder: FlowsFCLM_REUSECommon / Reusable Components
FCLM_FB_ITEMFlow Builder: Items from BSEG and BKPFFCLM_REUSECommon / Reusable Components
FCLM_FB_MD_UTFlow Builder unit test - simulate master data tableFCLM_REUSECommon / Reusable Components
FCLM_FB_VBKPF_UTVBKPF UT TableFCLM_REUSECommon / Reusable Components
FCLM_TGTolerances Groups for cash reconciliationFCLM_CASHRECONCILIATIONCash Reconciliation
FCLM_TGTName of Tolerances Groups for cash reconciliationFCLM_CASHRECONCILIATIONCash Reconciliation
ICSHCONCNBKACCTTI_CSHCONCNTP I_CSHCONCNBKACCTTPFCLM_CASHPOOLINGFor cash pooling
ICSHCONCNSDTI_CSHCONCNTP I_CSHCONCNSIMLNDETTPFCLM_CASHPOOLINGFor cash pooling
BANKACCWDI_BANKACCOUNTTP I_BANKACCOUNTTPFCLM_BAMBank Account Management
FCLM_BAM_HBA_IDXStandard index tableFCLM_BAMBank Account Management
FCLM_BAM_SIGPTN1Singatory Pattern Definition I: General CaseFCLM_BAMBank Account Management
FCLM_BAM_SIGPTN2Singatory Pattern Definition II: Special Case (Obsolete)FCLM_BAMBank Account Management
FCLMCONDI_BANKCONDITIONTP I_BANKCONDITIONTPFCLM_BRMBank Relationship Management
FCLMCONDITEMI_BANKCONDITIONTP I_BANKCONDITIONITEMTPFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_BSBTotal of Bank Service Billing StatementFCLM_BRMBank Relationship Management
FCLM_BRM_CONDBank ConditionFCLM_BRMBank Relationship Management
FCLM_BRM_COND_IBank Condition ItemFCLM_BRMBank Relationship Management
FCLM_BRM_PRC_STS[Obsolete] Service Pricing StatusFCLM_BRMBank Relationship Management
FDSPCash Mgmt Adjustment Items from Document SplittingFFCash Management
FEBPIPolling Statement Line Item InformationFTCMTreasury: Cash Management (SWIFT, BAI, Fed Wire)
T018ZCash Transfer: Payment Method Determination Payment RequestsFFCash Management
T028RTRANSRepetitive Transfer TransactionsFTCMTreasury: Cash Management (SWIFT, BAI, Fed Wire)
FDM_DOC_MIRRORDocument Information (Raw Data in Substitute System)FDM_AR_COLL_MIRRORSAP Collections Management - Data from Non-SAP System
FDM_INVOICE_MEMInvoice Information ProvidedFDM_AR_COLLECTIONFSCM Collections Management FI-AR
FDM_PERSONALIZEPersonalization of Collections ManagementFDM_AR_COLLECTIONFSCM Collections Management FI-AR
UKM_TRANSFER_ARData from AR for SAP Credit ManagementUKM_GENERALConnection to SAP Credit Management
UKM_TRANSFER_ARVData from AR for SAP Credit ManagementUKM_GENERALConnection to SAP Credit Management
UKMBP_VECTOR_ITSAP Credit Management: Credit SegmentUKM_BP_DBSAP Credit Management: Master Data
UKMBP_VECTOR_ITSAP Credit Management: Credit SegmentUKM_BP_DBSAP Credit Management: Master Data
UKMBP_VECTOR_ITSAP Credit Management: Credit SegmentUKM_BP_DBSAP Credit Management: Master Data
UKMBP_VECTOR_ITSAP Credit Management: Credit SegmentUKM_BP_DBSAP Credit Management: Master Data
UKM_ITEMCredit Management: Line ItemsUKM_BUSINESS_PARTNERSAP Credit Management - Business Partner
UKM_ITEM_SEQINCredit Management Line Items InboundUKM_BUSINESS_PARTNERSAP Credit Management - Business Partner
UKM_PM_BALANCESAP Credit Management: Liability TotalsUKM_BUSINESS_PARTNERSAP Credit Management - Business Partner
UKM_TOTALSSAP Credit Management: Liability TotalsUKM_BUSINESS_PARTNERSAP Credit Management - Business Partner
FQM_BALREC_SERSerialization Table for FQM Balance ReconsolidationFQMFinancial Quantity Management
FINSTA_POSTable for FINSTA Items (Used, e.g.,in CREATE_FINSTA)FKBIBank Customer Accounts: In-House Bank Functions
IHC_DB_CL_ACCTSAccount Determination for AMS UpdateFIN_IHCPayment Order In-House Cash
IHC_DB_CL_AMSIHC: Clearing Unit DataFIN_IHCPayment Order In-House Cash
IHC_DB_DSP_TRAPOTable Structure for displaying the Posted Item DetailFIN_IHCPayment Order In-House Cash
IHC_DB_INB_PARMSClearing Partner for PEXR2002FIN_IHCPayment Order In-House Cash
IHC_DB_INB_TARGTClearing Partner for PEXR2002FIN_IHCPayment Order In-House Cash
IHC_DB_TRAPOIHC: Customizing Table for Transfer Posting ReportFIN_IHCPayment Order In-House Cash
/PF1/T_CTRY_CURValid Country Currencies/PF1/BASIS_CUSTOMIZINGCustomizing for Payment Engine
/PF1/T_XML_PRIOCustomizing table for 'Determine Priority' of the order/PF1/FH_FORMAT_CUSTOMIZINGFormat-Dependent Customizing of the File Handler
TWH01Stock exchange tableFTPC_CORETR-CORE: Former Objects from FTPC (Customizing TR Portfolio)
TZPABFinancial Assets Management product typesFVVR/3 application development for Financial Assets Management
TZR3Application area / external role allocationFVVR/3 application development for Financial Assets Management
TZV07Alloc.of application/role category/dunning parametersFVVR/3 application development for Financial Assets Management
VTVSZYCScenario Database: Yield Curve TypesFTA_CORETR-CORE: Former Objects from FTA (Applic. Dev. TR General)
VWPZUSASecurities additional informationFVVR/3 application development for Financial Assets Management
VZGPOPartner/role object relationshipFVVR/3 application development for Financial Assets Management
VZPARZAPartner addit. data (general part)FVVR/3 application development for Financial Assets Management
FXM_BSRBalance Sheet Exposure Hedge RequestFXM_COREFX Risk Management Core
AFWGO_RSKFSEMKEYRisk Factors: Mapping of internal IDs to semantic KeyCFM_AFWGORDB: Process Control
AFWGO_RSKFSEMKEYRisk Factors: Mapping of internal IDs to semantic KeyCFM_AFWGORDB: Process Control
JBAPLANELASAVEALM: Maturity-Band-Dependent ParametersJBRARisk Management: Asset/Liability Management
JBAPLANPARLZBALM Assignment of Planning Parameters to Planning VariantJBRBRisk Management: Customizing for ALM
JBASIMLZBSAVEALM: Maturity-Band-Dependent ParametersJBRARisk Management: Asset/Liability Management
JBNIPLALM Non Interest Profit and LossJBA_USAnalytical Banking US
JBRSVGAPRESRM: Saved Gap Evaluation ResultsJBRARisk Management: Asset/Liability Management
JBRSVGAPRES2RM: Saved Gap Evaluation ResultsJBRApplication development TRM Market Risk Mangement
FTBB_YC_REF_ENTAttributes of Reference EntityFTBBYCMRA: New YC Framework -- New DDIC Objects
TMDT_MDCRFACTORSRisk factors assigned to a MDCR setFTBApplic. development R/3 Treasury risk simulation analysis
VTVBAR_HEDGEKey Figures for Hedge AccountingFTBApplic. development R/3 Treasury risk simulation analysis
VTVSZCTYScenario Database: Commodity Prices (OBSOLETE)FTBApplic. development R/3 Treasury risk simulation analysis
ATZVOReference Int. Rate Volatilities with Curve Info.FTB_COREFTB Core
VWPBONOSecurities listingFVVW_CORETR-CORE: Former Objects from FVVW (TR-TM: Securities)
AT24Currency-Dependent Rules for Calculating Derived FlowsFTAR/3 appl. development for Treasury money,forex,forward gen
AT25Amount-Dependent Rules for Calculating Derived FlowsFTAR/3 appl. development for Treasury money,forex,forward gen
BCKVWVORTRBACKUP: Carryover totals - securitiesFVVWTreasury Management: Securities
BCKVWVORTRBACKUP: Carryover totals - securitiesFVVWTreasury Management: Securities
REFCCReferences between CO object numbers, currency differencesFTRApplication development R/3 Treasury referencing (unit)
TCORT_CODPIDeal: Payment InformationFTR_CORRESPONDENCETreasury Correspondence (Confirmations & Matching)
TCURKCurrency Code Table SupplementsFTDR/3 Application development for Treasury foreign exchange
TERTINERKOHeader Information for Executing Security RightsFVVWTreasury Management: Securities
TERTINERKOHeader Information for Executing Security RightsFVVWTreasury Management: Securities
TERTINERKOHeader Information for Executing Security RightsFVVWTreasury Management: Securities
TERTINERKOHeader Information for Executing Security RightsFVVWTreasury Management: Securities
TERTINERKOHeader Information for Executing Security RightsFVVWTreasury Management: Securities
TERTINERKOHeader Information for Executing Security RightsFVVWTreasury Management: Securities
TERTINERKOHeader Information for Executing Security RightsFVVWTreasury Management: Securities
TERTINERKOHeader Information for Executing Security RightsFVVWTreasury Management: Securities
TERTINERKOHeader Information for Executing Security RightsFVVWTreasury Management: Securities
TERT_TRANSACTIONBusiness Transaction: Exercise of RightsFVVWTreasury Management: Securities
TERT_TRANSACTIONBusiness Transaction: Exercise of RightsFVVWTreasury Management: Securities
TERT_TRANSACTIONBusiness Transaction: Exercise of RightsFVVWTreasury Management: Securities
TERT_TRANSACTIONBusiness Transaction: Exercise of RightsFVVWTreasury Management: Securities
TERT_TRANSACTIONBusiness Transaction: Exercise of RightsFVVWTreasury Management: Securities
TERT_TRANSACTIONBusiness Transaction: Exercise of RightsFVVWTreasury Management: Securities
TERT_TRANSACTIONBusiness Transaction: Exercise of RightsFVVWTreasury Management: Securities
TERT_TRANSACTIONBusiness Transaction: Exercise of RightsFVVWTreasury Management: Securities
TERT_TRANSACTIONBusiness Transaction: Exercise of RightsFVVWTreasury Management: Securities
THAHRT_ASS_PROSPRetrospective effectiveness assessment resultFTHMHedge Management - central objects
THAHRT_EFF_DATAData points for the Effectiveness testFTHM_HEDGING_RELATIONSHIPHedge Management - Package hedging relationship
THMHRT_ASS_RETRORetrospective effectiveness assessment resultFTHMHedge Management - central objects
THMHRT_HI_MEASFair value change of the hedge comp. in an effective hedgeFTHMHedge Management - central objects
THMHRT_MEASUREEffectiveness measurement resultFTHMHedge Management - central objects
TRGT_TRANS_REVALTable with Revaluation Structures for Transfer to TR LedgerFTR_GENERALCFM TM: Application Basis / Global Objects
TRQT_VWVORTR_LOT(obsolete)FTR_QUANTITY_LEDGERTreasury: Quantity Ledger
TRQT_VWVORTR_LOT(obsolete)FTR_QUANTITY_LEDGERTreasury: Quantity Ledger
VTBMACRM. Agreement: Permitted CurrenciesFTAR/3 appl. development for Treasury money,forex,forward gen
VTBZVPayment Details for TransactionFTAR/3 appl. development for Treasury money,forex,forward gen
VWBEPPTreasury Securities: Planned FlowsFVVWTreasury Management: Securities
VWBEPPTreasury Securities: Planned FlowsFVVWTreasury Management: Securities
VWORDEOrder DataFVVWTreasury Management: Securities
VWORDEOrder DataFVVWTreasury Management: Securities
VWPWPKUSecurity pricesFVVWTreasury Management: Securities
VWVORTRSecurities: Carry-Forward TotalsFVVWTreasury Management: Securities
VWVORTRSecurities: Carry-Forward TotalsFVVWTreasury Management: Securities
AT26Non Deliverable CurrenciesFTTRTreasury: Financial Transaction
THXT_MD_ACC_KFMarket Data: Hedge Accounting Key FiguresFTR_TRL_HEDGE_MANAGEMENTNew Hedge Management
VTB_ASGN_RELATFTR Assignment Management: Assignment ObjectFTTRTreasury: Financial Transaction
VTB_RULESET_CRFTR Rule Management: Transaction Currency RulesFTTRTreasury: Financial Transaction
TTMC_ROUNDINGFX: Rounding RulesFTR_TTM_FXForeign Exchange Transactions
BP2000BP: Business Partner - Business Partner - RelationshipFBPARBusiness Partner (Treasury/Real Estate)
VTBSTA1Allocation of Payment Details as Standing InstructionsFTBP_SIFS Business Partner: Standing Instructions
VTBSTC1Components of Payment Details for Standing InstructionFTBP_SIFS Business Partner: Standing Instructions
TTONFTVZZBEPPTest new FIMA: VZZBEPPFVVD_TEST_NEW_FIMATest of New FIMA
TTONFTVZZBEPPTest new FIMA: VZZBEPPFVVD_TEST_NEW_FIMATest of New FIMA
MZDATDunning and interest data for batch inputFVVDTreasury Loans
TDCOND_PROPCurrency-Dependent Default Setting of ConditionsFVVD_CHCML - Country-Specifc Requirements for Switzerland
TDROUND_ACT_WAERActive Currencies for RoundingFVVD_CHCML - Country-Specifc Requirements for Switzerland
TDRXXForeign currency loan with special coverageFVVDTreasury Loans
TDV08Alloc.of application/role category/dunning parametersFVVDTreasury Loans
TSZE1Sales data for acct statementsFVVDTreasury Loans
TSZE1Sales data for acct statementsFVVDTreasury Loans
TZFSPRelease status parametersFVVDTreasury Loans
VDARC_DOC_ADMAdmin. Table for Reorganization of Loan Document DataFVVD_ARCHIVELoan Reorganization and Archiving
VDBLBAWCollateral Value Building ValueFVVDTreasury Loans
VDBLBOWLand value collateral valueFVVDTreasury Loans
VDBLEWRevenue value collateral valueFVVDTreasury Loans
VDBLREWCollateral Value Gross Revenue Value per Building PartFVVDTreasury Loans
VDBLSWTCollateral Value Real Value Resid. Prop./Part-Owners.FVVDTreasury Loans
VDCHK_TRL_REVVDCHK_TRL_REVFVVDTreasury Loans
VDGPOLoan: Relationship Partner/Role ObjectFVVD_PARTNERLoans Specific Objects in SAP Business Partner
VDHOBJCollateral ObjectsFVVDTreasury Loans
VDHOBJBLDetermination of collateral value/Expert report of objectFVVDTreasury Loans
VDLVContracts/Credit (life ins., build.savings etc) basic dataFVVDTreasury Loans
VDSDV4Loan collateral in acc. with BAV/PRF4FVVDTreasury Loans
VDSDV5Collateral in securities in acc. with BAV/PRF5FVVDTreasury Loans
VDSEPA_MND_USGOverview of mandates used in Loans ManagementFVVDTreasury Loans
VDSONSISpecial Arrangements for CollateralFVVDTreasury Loans
VDUNTRFile documents for loan allocationFVVDTreasury Loans
VDVORTRLoan carry-forward totalsFVVD_DELETEObsolete CML Objects
VDVORTRLoan carry-forward totalsFVVD_DELETEObsolete CML Objects
VDZNB_USAGEPayment Postprocessing: Usage of a Payment Postpr. ActivityFVVDTreasury Loans
VDZVPayment Details for the LoanFVVZTR-LO: Payment Requests for Loans
VZFGDRelease data (Informative data for the release procedure)FVVDTreasury Loans
VZFZE_VDNBZECentral Entry Table for Release ProcedureFVVDTreasury Loans
VZFZE_VDNBZECentral Entry Table for Release ProcedureFVVDTreasury Loans
TZB41Account Clearing: Amount LimitsFVVD_PAYMENTLoans Payment Transactions
VDAD_HISTAuto Debits, Historical DataFVVD_PAYMENT_USUS Specific Payment Processing for Loans
VDARL_RLSDirect Debits Per ContractFVVD_PAYMENTLoans Payment Transactions
TDCLI_INSURANCETable of Credit Life Insurance RatesFVVCL_KLVCredit Life Insurance
TDCLI_INS_1Table of Credit Life Insurance RatesFVVCL_KLVCredit Life Insurance
VDBILL_HISTBilling HistoryFVVD_BILLLoans - Billing
VDBILL_ITEMSBilling ItemsFVVD_BILLLoans - Billing
TMR94Currency ConversionFVVORate/price transfer via data media - Austria
CACS00_DOCFI_PData Transfer: FI Documents (Items)CACSCCICM: Commission Case 'Light'
TCACS_AUT08ATable with Quantifying Authorizations for Amount FieldsCACSAUICM: Authorization
TCACS_AUT08DTable with Quantifying Authorizations for ConditionsCACSAUICM: Authorization
CACSHR_DOCHR_PDSettlement to PY: Reference Line ItemCACSXHR5ICM: HR Adapter: DDIC + APIs for DDIC
IMTPInvestment programsAIPIM capital investment prog.(master data, budget, info syst.)
TAIGWDefinition of the scale of investment measuresAIPIM capital investment prog.(master data, budget, info syst.)
S491CEM Construction Site Stock ValueDIMP_GENERAL_APPGeneral Functions DIMP Industries - Append Structures
S491ES491 - Structure InformationDIMP_GENERAL_APPGeneral Functions DIMP Industries - Append Structures
S492CEM Total Costs for EquipmentDIMP_GENERAL_APPGeneral Functions DIMP Industries - Append Structures
S492ES492 - Structure InformationDIMP_GENERAL_APPGeneral Functions DIMP Industries - Append Structures
ISAERSLISTERS Collective Settlement ListISAUTO_MRMEnhancements to Log. IV; ERS With Handling Surcharge, Reval.
CVLC23VELO : Assign Organization Data to VMS RolesISAUTO_VLCVehicle Management System (VMS)
VLCBATCHACTVELO : Variant for Action Execution in BatchISAUTO_VLCVehicle Management System (VMS)
VLCBATCHACTVELO : Variant for Action Execution in BatchISAUTO_VLCVehicle Management System (VMS)
VLCGPRICEORGVELO : Organization Data for Gross List Price DeterminationISAUTO_VLCVehicle Management System (VMS)
ORF2CUSTCustomising Profils for Optimal Rotable Float ORF1,2,4AD_ROT_CALCStock Calculation: Rotables & Expendables
ORF5CUSTCustomising Profils for Optimal Rotable Float ORF5,6AD_ROT_CALCStock Calculation: Rotables & Expendables
ORFCALCData Record ORF Calculation, ATTENTION: MOVE-CORR!AD_ROT_CALCStock Calculation: Rotables & Expendables
ORFCALCData Record ORF Calculation, ATTENTION: MOVE-CORR!AD_ROT_CALCStock Calculation: Rotables & Expendables
ORFCALCData Record ORF Calculation, ATTENTION: MOVE-CORR!AD_ROT_CALCStock Calculation: Rotables & Expendables
ORFECTORF: Essentiality-Code TableAD_ROT_CALCStock Calculation: Rotables & Expendables
AD01DLISFRResource-related billing: DLI flow totals revenue by rev elAD_RRBA&D - Resource-Related Billing
RTP_US_RMDRequired minimum distributionBCA_USBCA modification for US specific requirements
BKKI4Totals Records from Payment TransactionsFKBPBank Customer Accounts: Payment Item
BKKI5Totals Records from Payment TransactionsFKBPBank Customer Accounts: Payment Item
BKKI6Totals Records from Payment TransactionsFKBPBank Customer Accounts: Payment Item
BKK81Bank ConditionFKBCBank Customer Accounts: Conditions
BKK82Bank Condition ItemFKBCBank Customer Accounts: Conditions
BKK83Bank Condition DeterminationFKBCBank Customer Accounts: Conditions
BKK84Bank Account - Individual ConditionFKBCBank Customer Accounts: Conditions
BKK85Bank Account - Individual Condition PositionFKBCBank Customer Accounts: Conditions
TBKK8MTrivial AmountsFKBCBank Customer Accounts: Conditions
BKKC02General Ledger: Posting Totals for FIFKBHBank Customer Accounts: General Ledger Integration
TBKKC_BUKRSBCA Locally Duplicated Values for Corresponding FIFKBHBank Customer Accounts: General Ledger Integration
/FMP/D_MP_HISTMaterial Price History/FMP/MP_DDICFlexible Material Prices
/FMP/D_MP_PRICMaterial Prices/FMP/MP_DDICFlexible Material Prices
/SAPBOQ/HEADERHeader of service package BOQ/SAPBOQ/DDICSAP: Bill of Quantities - Dictionary Objects Definition
ADBOS_ECP_CKISBOS: Enhancement to Detailed StatementAD_BOS_ECPConnection Easy Cost Planning BOS
J_3GVERSITax/Insurance DataJ3GDCEM Dictionary Objects
J_3GVERSITax/Insurance DataJ3GDCEM Dictionary Objects
/SAPMP/SD_LGSTControl Table for Rental Fees/SAPMP/SD-RTMill Products: Returnable Reel Processing
SAWE_D_SA_ITMStaff Assignment object itemPSAWE_SA_BL
TCCCRCITMPRCG_DI_CNDNCONTRCLMREQTP I_CNCONCLMREQCUSTITMPRCGTPSTM_CLAIM_REQUESTClaim Request
TCCCRCUSTPRCG_DI_CNDNCONTRCLMREQTP I_CNDNCONTRCLMREQCUSTPRCGTPSTM_CLAIM_REQUESTClaim Request
/DSD/HH_RACLDSD Route Settlement: Clearing/DSD/HHHandheld
/DSD/HH_RACOCICIDSD Route Settlement: Check-Out/Check-In - Money Item/DSD/HHHandheld
/DSD/HH_RADELCDDSD Route Settlement: Delivery Execution Conditions/DSD/HHHandheld
/DSD/HH_RADELCNDDSD Route Settlement: Delivery Execution Conditions/DSD/HHHandheld
/DSD/HH_RAECDSD Route Settlement: Receipts/Expenditures/DSD/HHHandheld
/DSD/HH_RAIVCDDSD Route Settlement: HH Invoice Header Conditions/DSD/HHHandheld
/DSD/HH_RAIVCNDDSD Route Settlement: HH Invoice Header Conditions/DSD/HHHandheld
/DSD/SL_POSTSETDSD Collection: Posting Ctrl. Driver Receipts/Expenditures/DSD/SLRoute Settlement
/DSD/SL_SLD_MBALSettlement Document: Payment Differences/DSD/SLRoute Settlement
/DSD/SL_SLD_QBALSettlement Document: Quantity Differences/DSD/SLRoute Settlement
/DSD/SL_TGGRPDSD Settlement: Tolerance Groups/DSD/SLRoute Settlement
/DSD/SV_RACOCICIDSD SV: Check-Out / Check-In - Money Item/DSD/SV
WLF_D_FCAPRCHD_DDraft table for entity R_FRTCOSTALLOCPRCGELMNTTPRAP_LO_ABBehavior Model and Implementation for Settlement Management
WLF_D_FCAPRCIT_DDraft table for entity R_FRTCOSTALLOCITMPRCGELMNTTPRAP_LO_ABBehavior Model and Implementation for Settlement Management
MEV_D_AD_ROOTPeriod-End Valuation: Accruals Document RootLOG_CMM_MEV_GEN_BO
MEV_D_WL_ITEMPeriod-end valuation: Worklist itemLOG_CMM_MEV_GEN_WL
CMM_VLOGPVersion TableLOG_CMM_RUNTIME_VALUATIONRuntime Valuation of logistics documents
WBHDTrading Contract: Business DataWB2B_DDICGlobal Trade Management: DB-Tables and xPRAS
WBHITrading Contract: Item DataWB2B_DDICGlobal Trade Management: DB-Tables and xPRAS
WB2_D_BUSVOLRebates: Business VolumeWB2_REBATESCondition Contract Settlement
WB2_D_BVDETAILCondition Contract: Settlement Detailed StatementWB2_REBATESCondition Contract Settlement
WCOCOFUsage of Condition Contract ConditionsWCB_CC_PERSCondition Contract Persistence Layer
GTCN_TRAN_CURRCurrency Translation for VerificationGLO_GLT_TR_VERIF_CNElectronic Foreign Exchange Verification (China)
GTCN_TR_F_ITEMTax Refund File ItemGLO_GLT_TR_TAXREF_CNTax Refund: Global Trade Localization for China
GTCN_TR_POST_HTax Refund Posting HeaderGLO_GLT_TR_TAXREF_CNTax Refund: Global Trade Localization for China
TB2BE_CSTrading Contract: Contract Settlement controlWB2BTrading Contract Application
TSTATUSCUST_PROFTrading Contract: Table of Status FieldsWB2BTrading Contract Application
S008Communications Table SD -> CO/ProjectsMCSR/3 application development: Logistics Information Warehouse
S026Material UsageMCSR/3 application development: Logistics Information Warehouse
S026ES026 - Structural InformationMCSR/3 application development: Logistics Information Warehouse
S031Statistics: Movements for current stocksMCSR/3 application development: Logistics Information Warehouse
S032Statistics: Current Stock and Grouping TermsMCSR/3 application development: Logistics Information Warehouse
S033Statistics: Movements for Current Stock (Individual Records)MCSR/3 application development: Logistics Information Warehouse
S038All Key Figures for Batch AnalysisMCSR/3 application development: Logistics Information Warehouse
S039Statistics: Inventory ControllingMCSR/3 application development: Logistics Information Warehouse
S226Material usage: repetitive manufacturingMCSR/3 application development: Logistics Information Warehouse
S226ES226 - Structural InformationMCSR/3 application development: Logistics Information Warehouse
STPOBOM itemCSR/3 Application development: PP Bills of Material
STPO_DRAFTDraft Data for BillOfMaterial ItemCS_MODELBills of Material Model Objects
STPO_DRAFT_V2I_BILLOFMATERIALTP I_BILLOFMATERIALITEMTPCS_MODELBills of Material Model Objects
BPADDSCC_DI_BUSINESSPARTNERTP I_BPADDLSUPLRCOMPANYCODETPVDM_MD_BPVDM Master Data BP
BUPA_REL_CI_DI_BUSINESSPARTNERTP I_BPRELSHPCOMPANYINTERESTTP_2VDM_MD_BPVDM Master Data BP
SUPP_CC_DI_BUSINESSPARTNERTP I_BUSINESSPARTNERSUPLRCOTPVDM_MD_BPVDM Master Data BP
LFB1Vendor Master (Company Code)WLIFCOREGeneral services vendor master
MAPEMaterial Master: Export Control FileMGApplication development R/3 material master prior to 3.0
MDIPMaterial: MRP Profiles (Field Contents)MGApplication development R/3 material master prior to 3.0
PROD_MLPRICESI_PRODUCTWD I_PRODUCTMLPRICESTPVDM_MD_PRODUCTVDM Master Data Product
PROD_PLANT_SUPPLI_PRODUCTWD I_PRODUCTSUPPLYPLANNINGWDVDM_MD_PRODUCTVDM Master Data Product
PROD_PLNT_MRPI_PRODUCTWD I_PRODUCTPLANTMRPTPVDM_MD_PRODUCTVDM Master Data Product
PROD_VALACCTI_PRODUCTWD I_PRODUCTVALUATIONACCTTPVDM_MD_PRODUCTVDM Master Data Product
PROD_VALCOSTI_PRODUCTWD I_PRODUCTVALUATIONCOSTINGTPVDM_MD_PRODUCTVDM Master Data Product
PROD_VALN_CURI_PRODVALNMATLLDGRCURPERDTP I_PRODVALNMATLLDGRCURPERDTPVDM_MD_PRODUCTVDM Master Data Product
PROD_VALUATIONI_PRODUCTWD I_PRODUCTVALUATIONWDVDM_MD_PRODUCTVDM Master Data Product
PROD_VAL_MLACTI_PRODUCTWD I_PRODUCTMLACCOUNTWDVDM_MD_PRODUCTVDM Master Data Product
WTADABAdditionals: DocumentsWTADIS-R: Additionals
ARUN_RC_RUN_DETLScheduled Release Check Run Detail InformationARUN_RELEASE_CHECKPackage for Objects of Release Check Application
FRE_BIF_OPI_INInbound Interface Table Order Proposal ItemWFRE_PIConnectivity with F&R
FRE_DB_ART_SITERelevant article/site-combinations for F&RWFRE_PIConnectivity with F&R
FRE_DB_VKP_TDF&R Sales Price TDWFRE_PIConnectivity with F&R
FRE_IF_CONTRACTInterface Table for Contracts DataWFRE_PIConnectivity with F&R
FRE_IF_ITEMF&R Order Outbound IF: internal Item TableWFRE_PIConnectivity with F&R
FRE_OP_ITEM_INF&R CON R/3 - Order Proposal Inbound Item BufferWFRE_PIConnectivity with F&R
WBB_SAVE2Temporary Assortment List Objects: Store-SpecificWBBCNAssortment List: Enterprise AddOn
WVFBDRS Interface, Intermediate Buffer, Order Item FMWFWWIS-R: SMMS interface
WRF_ORGPRICEOriginal PriceWRF_ORGPRICE_DDICWWS: Original Price
WRF_ORGPRICEOriginal PriceWRF_ORGPRICE_DDICWWS: Original Price
RFM_CBC_ARTICLECBC: Table for Ecatt /SMB99/RFM_ARTICLE_ALL_VIEWSRFM_PRODUCT_CORERetail Product Core Objects
RFM_CBC_ARTICLECBC: Table for Ecatt /SMB99/RFM_ARTICLE_ALL_VIEWSRFM_PRODUCT_CORERetail Product Core Objects
WELPCompetitor: Price Entry Document (Item)WVKPIS-R: Sales pricing
WKBPPricing document: itemWVKPIS-R: Sales pricing
J_1IRAINCNDArticle Inward Note ConditionsJ1IRETRetail India Localization
J_1IRAINDTLArticle Inward Note DetailJ1IRETRetail India Localization
J_1IRAINHDRArticle Inward Note HeaderJ1IRETRetail India Localization
J_1IRAINHDRArticle Inward Note HeaderJ1IRETRetail India Localization
J_1IRTGRPTolerance Group SettingsJ1IRETRetail India Localization
J_1IRTGRPTolerance Group SettingsJ1IRETRetail India Localization
WSTN_PP_PURCHPrepack definition - Purchasing price tableWSTRNPrepack Allocation Planning Dialog
FIP_D_ORDER_LINEOrder lines for FIPFIP_DDICDDIC package for Fresh Item Procurement
FIP_D_STAT_ROQTable containing the Recipient Order Quantity stat. dataFIP_DDICDDIC package for Fresh Item Procurement
TREC_FORC_COMPLTemporary data for the receiving forecastWAO_46C_RETAIL_STOREMiniApp: Open Goods Receipt (Release-Dependent 46C Part)
AUBFDocument Flow SAP Retail (Allocation Table, Promotions...)WAUFApplication development R/3 Purchasing, Allocation table
TWBO1Customizing table for opt. PO-based load building profilesW6Application development R/3 Stock planning
TWBO3Text table for restrictionsW6Application development R/3 Stock planning
WBO2Log item file for simulative list for load buildingWVLBRetail Load Building
WBO3Log file for investment buyW6Application development R/3 Stock planning
WDFR1Requirements Planning for PerishablesWO+GRetail Development for Perishables
WDFR_POSPerishables Planninng ItemWO+GRetail Development for Perishables
WDFR_POSPerishables Planninng ItemWO+GRetail Development for Perishables
WDFR_POSPerishables Planninng ItemWO+GRetail Development for Perishables
WDFR_POSPerishables Planninng ItemWO+GRetail Development for Perishables
RPO_D_ITEM_BUFBuffer Table for Replenishment with Purchase OrdersMMPUR_RPOReplenishment Orders
WRF_APC_IBIDPurchasing List Inbound Interface Detailed TotalsWRF_APCOperational Assortment Planning and Control
WRF_APC_IBITPurchasing List Inbound Interface TotalsWRF_APCOperational Assortment Planning and Control
WRF_APC_PAPURPlanned Article Purchasing Data and PricesWRF_APCOperational Assortment Planning and Control
WRF_APC_PAPURPlanned Article Purchasing Data and PricesWRF_APCOperational Assortment Planning and Control
WRF_APC_PLIPurchasing List ItemsWRF_APCOperational Assortment Planning and Control
WRF_APC_PLIPurchasing List ItemsWRF_APCOperational Assortment Planning and Control
WRF_APC_PLIPOAPC: Purchasing List Item Prepack InformationWRF_APCOperational Assortment Planning and Control
WRF_APC_PLIPOAPC: Purchasing List Item Prepack InformationWRF_APCOperational Assortment Planning and Control
WRF_APC_PLPLPurchasing List Planned DataWRF_APCOperational Assortment Planning and Control
WRF_APC_PLPOQPurchasing List Purchase Order QuantitiesWRF_APCOperational Assortment Planning and Control
WRF_PCON_INRATInternal Contract ApportionmentWRF_PRC_CON_DDICSeasonal Procurement: DDIC Objects Contract
WRF_POHF_POLOrder listWRF_PRC_POHF_DDICSeasonal Procurement: DDIC Objects PO Processing
WRF_PRCT_WL_ITEMOriginal Table for Worklist ItemsWRF_PRC_CTR_DDICSeasonal Procurement: DDIC Objects Procurement Controlling
WRF_PRCT_WL_SHDWShadow Table for Worklist ItemsWRF_PRC_CTR_DDICSeasonal Procurement: DDIC Objects Procurement Controlling
WOSCR_EXI_CURRCurrencies for Expense InvoiceWOST_CR_EXIRetail Store: Expense Invoice
WSTI_POS_EVENTPhysical Inventory in an Opened Store: POS Trans by ReceiptWOSTSAP Retail Store: Internet Application Components
WSGR_ITEM_DB_TMPSRS GR: Temporary Persistence for Item DataWOST_WSGM_GR_MODELRetail Store: Goods Receipt - Model Components
RFM_ST_STKADJITMStore Stock Adjustment: Item DataRFM_STORE_STOCK_ADJUSTMENTRetail Store Business Object: Stock Adjustment
COUNT_CA_ITEMFiori Count Stock CA Details (Line Item)ODATA_RETAIL_ST_COUNT_STOCKOData Service - Retail Store Count Stock
COUNT_CA_PRODUCTFiori Count Stock CA ProductsODATA_RETAIL_ST_COUNT_STOCKOData Service - Retail Store Count Stock
TRF_DOC_DETAILSFiori Transfer Stock Document Details (Items)ODATA_RETAIL_ST_TRF_STOCKOData Service - Retail Store Transfer Stock
TRF_DOC_HEADFiori Transfer Stock Document HeaderODATA_RETAIL_ST_TRF_STOCKOData Service - Retail Store Transfer Stock
OBOM_WB_D_VERSOEWB: IBase Component, Additional Data for VersionVCH_HL_OBOM_WB_COREOrder Engineering Workbench: Basic Functions
/OEWB/D_VERSOEWB: IBase Component, Additional Data for Version/OEWB/COREOrder Engineering Workbench: Basic Functions
WTY_PRCD_ITEMS_DDraft table for entity R_WRNTYCLAIMITEMPRICINGTPRAP_LO_WTYRAP WTYBehavioral and Model Implementation Artifacts package
WTY_PRCD_VERS_DDraft table for entity R_WRNTYCLAIMACTVVERSITEMPRCGTPRAP_LO_WTYRAP WTYBehavioral and Model Implementation Artifacts package
PFSIAMNTPREDOUTFinancial Statement Expected AmountFIN_STATEMENT_INSIGHT_APP_1Financial Statement Insights App ML
ROWAIndex table : Chargeable component consumptionsMOSubcontracting Index Table
ROWAIndex table : Chargeable component consumptionsMOSubcontracting Index Table
BBPD_CTR_IDOCREFReference of contract number for Create IdocsBBP_ADDON_46BAdd-Ons for BBP From 4.6b
ISEGPhysical Inventory Document ItemsMBApplication development R/3 inventory management
MSEGDocument Segment: MaterialMBApplication development R/3 inventory management
MWXMSEGZMSEG: Interface for Posting of ValueMBApplication development R/3 inventory management
MWXVM07MFields: Update Control of Module Pool SAPMM07MMBApplication development R/3 inventory management
MWZDM07M1ZDM07M1MBApplication development R/3 inventory management
MWZMSEGZMSEG:Interface for Posting of ValueMBApplication development R/3 inventory management
MWZVM07MFields: Update Control of Module Pool SAPMM07MMBApplication development R/3 inventory management
RESBReservation/dependent requirementsMBApplication development R/3 inventory management
SBSEStock Mngmt Levels for Inventory SamplingMBApplication development R/3 inventory management
MATDOCMaterial DocumentsMBND_RESTRICTEDMM: Inventory Management New Data Model Restricted Usage
MATDOC_EXTRACTMaterial Documents: Stock Change DataMBND_RESTRICTEDMM: Inventory Management New Data Model Restricted Usage
NSDM_D_MTDCSAOBSOLETE � NO DATA ANYMORE use MATDOC insteadMBND_RESTRICTEDMM: Inventory Management New Data Model Restricted Usage
NSDM_MM_CHK_LOGRConsistency check log MATDOC referenceMBND_RESTRICTED_INCON_CHECKInconsistency Check for new data model
NSDM_AGING_CHECKAged material transaction documents check resultsMBND_AGINGMM: Inventory Management New Data Model Aging
IMRS_D_DOC_ITEMDraft table for entity R_RESERVATIONDOCUMENTITEMTPMM_IM_RAP_RESMM-IM Restful ABAP Programming (Reservation)
CKMLPR_EB_FILEStructure for up-/download Valuation AlternativeMRYBalance Sheet Valuation
CKMLPR_EB_MATPrices for Ending Inventory/Balance Sheet ValuationMRYBalance Sheet Valuation
MYLAUFCRObject Table for Delta Run including Ledger and Crcy TypeMRYBalance Sheet Valuation
MYML1VLIFO: Transaction-Related Material Layer (Values)MRYBalance Sheet Valuation
FBV_RESULTResult Table for Inventory Balane Sheet Valuation runsFINS_BSV_COMMONBalance Sheet Valuation - Common Things
MMPUR_ANAEXTEKETConsoludated Table for Central PO, Item, SchedulelineODATA_MM_ANALYTICSODATA Services for MM Analytics
MMPUR_ANA_CENCTRCentral Contracts Price data for analyticsODATA_MM_ANALYTICSODATA Services for MM Analytics
MMPUR_ANA_VALPRCCentral Contract Price ComponentsODATA_MM_ANALYTICSODATA Services for MM Analytics
EVAL_IV_RES_HDResults of Vendor Evaluation (Header)VEND_EVALUATION_IVVendor Evaluation From Invoice Verification Documents
RBDIFFKOInvoice Verification - ConditionsMRMAppl. Development: R/3 Decentralized Invoice Verification
RBDIFFKOInvoice Verification - ConditionsMRMAppl. Development: R/3 Decentralized Invoice Verification
RBDPCInvoice Verification: Down Payment ClearingMRMAppl. Development: R/3 Decentralized Invoice Verification
RBDRSEGBatch IV: Invoice Document ItemsMRMAppl. Development: R/3 Decentralized Invoice Verification
RBKPDocument Header: Invoice ReceiptMRMAppl. Development: R/3 Decentralized Invoice Verification
RKWAConsignment WithdrawalsMRIncoming Invoices
T169GTolerance Limits, Invoice VerificationMRIncoming Invoices
T169WF01IV Workflow: Amounts for Release in Invoice ParkingMRMAppl. Development: R/3 Decentralized Invoice Verification
MMIV_SI_D_GL_ITMItem G/L Account - #GENERATED#APPL_MM_IV_MODELDevelopment MM Invoice Verification for sSuite
MMIV_SI_D_ITEMItem with PO Reference - #GENERATED#APPL_MM_IV_MODELDevelopment MM Invoice Verification for sSuite
MMIV_SI_D_ITEMItem with PO Reference - #GENERATED#APPL_MM_IV_MODELDevelopment MM Invoice Verification for sSuite
MMIV_SI_D_ITEMItem with PO Reference - #GENERATED#APPL_MM_IV_MODELDevelopment MM Invoice Verification for sSuite
MMIV_SI_D_LIMITSum table for limitsAPPL_MM_IV_MODELDevelopment MM Invoice Verification for sSuite
MMIV_SI_D_PST_ITPosting item of simulation - #GENERATED#APPL_MM_IV_MODELDevelopment MM Invoice Verification for sSuite
MMIV_SI_D_ROOTSupplier Invoice Root - #GENERATED#APPL_MM_IV_MODELDevelopment MM Invoice Verification for sSuite
MMIV_SI_D_SIM_SUSimulation Summary - #GENERATED#APPL_MM_IV_MODELDevelopment MM Invoice Verification for sSuite
EBANPurchase RequisitionMEPurchasing
EINEPurchasing Info Record: Purchasing Organization DataMEPurchasing
EIPAOrder Price History: Info RecordMEPurchasing
EIPAOrder Price History: Info RecordMEPurchasing
EKABRelease DocumentationMEPurchasing
EKBEHistory per Purchasing DocumentMEPurchasing
EKBEHRemoved PO History RecordsMEPurchasing
EKBE_SRV_SUMTotals History for SRV DocumentsMEPurchasing
EKBZHistory per Purchasing Document: Delivery CostsMEPurchasing
EKBZHHistory per Purchasing Document: Delivery CostsMEPurchasing
EKBZH_MAHistory Table Delivery Costs at Account Assignment LevelMEPurchasing
EKBZH_MAHistory Table Delivery Costs at Account Assignment LevelMEPurchasing
EKBZ_MADelivery Costs at Account Assignment LevelMEPurchasing
EKBZ_MADelivery Costs at Account Assignment LevelMEPurchasing
EKCPHPurchasing Contract Commitment Plan Header InformationMEPurchasing
EKKOPurchasing Document HeaderMEPurchasing
EKPO_DISTRPurchasing Document Item DistributionMEPurchasing
EREVVersion in PurchasingMEDCMPurchasing: Change Management
MMPRC_CCTR_RELORCalloff data for Central contracts in HubMEPurchasing
MMPRC_CC_CALLOFFCalloff data for Central contracts in HubMEPurchasing
MMPUR_ANA_EKETAnalytical Data for Schedule LinesMEPurchasing
T161IDetermination of Release StrategyMEPurchasing
T16F_CRITERIARelease CriteriaMEPurchasing
/BEV1/NEINVBALBalances of Empties Qties and Empties Values f. Inv.Receipt/BEV1/NEEmpties Management in MM: General
/BEV1/NEINVITMEmpties Quantities and Values from Invoice Receipt/BEV1/NEEmpties Management in MM: General
MMPUR_SUPCONFDSupplier Confirmation DetailRAP_MM_PUR_CONFRAP artifacts for Supplier Confirmation
MMPUR_SUPCONFD_DDraft table for entity R_SUPPLIERCONFIRMATIONLINERAP_MM_PUR_CONFRAP artifacts for Supplier Confirmation
MMPUR_EXT_EKBEHistory per Purchasing DocumentAPPL_PROC_HUB_CPOS4HANA Procurement Hub : Central Purchase Order
MMPUR_EXT_EKETScheduling Agreement Schedule LinesAPPL_PROC_HUB_CPOS4HANA Procurement Hub : Central Purchase Order
MMPUR_EXT_EKKOPurchase Document HeaderAPPL_PROC_HUB_CPOS4HANA Procurement Hub : Central Purchase Order
MMPUR_EXT_PRCD_EPricing ElementsAPPL_PROC_HUB_CPOS4HANA Procurement Hub : Central Purchase Order
MMPUR_EXT_EBANMaintain Extracted Back-end RequisitionsAPPL_PROC_HUB_PR_EXTS4HANA Procurement Hub : PR extraction
MMPURHUB_AIF_IDXAIF index table for procurement hubAPPL_PROC_HUB_EHMError handling and monitoring for procurement hub
CPOPRICINGTP_DI_CENTRALPURCHASEORDERTP I_CNTRLPURORDERPRCGELEMENTTPAPPL_MM_PUR_EXT_POManage External Purchase Order Application Logic
CPOPRICINGTP_DI_CENTRALPURCHASEORDERTP I_CNTRLPURORDERPRCGELEMENTTPAPPL_MM_PUR_EXT_POManage External Purchase Order Application Logic
CPOPRICINGTP_DI_CENTRALPURCHASEORDERTP I_CNTRLPURORDERPRCGELEMENTTPAPPL_MM_PUR_EXT_POManage External Purchase Order Application Logic
CPOPRICINGTP_DI_CENTRALPURCHASEORDERTP I_CNTRLPURORDERPRCGELEMENTTPAPPL_MM_PUR_EXT_POManage External Purchase Order Application Logic
CPURORDITMTP_DI_CENTRALPURCHASEORDERTP I_CENTRALPURCHASEORDERITEMTPAPPL_MM_PUR_EXT_POManage External Purchase Order Application Logic
CPURORDTP_DI_CENTRALPURCHASEORDERTP I_CENTRALPURCHASEORDERTPAPPL_MM_PUR_EXT_POManage External Purchase Order Application Logic
MMPUR_PRFOD_DHHeader Data of Follow-on DocumentODATA_MM_PUR_EXT_PROData objects for Process External PR centrally
MMPUR_PRFOD_DIItem Data of Follow-on DocumentODATA_MM_PUR_EXT_PROData objects for Process External PR centrally
CNTRLQTNDISTR_DI_CENTRALSUPPLIERQUOTATIONTP I_CNTRLSUPPLIERQTANITEMDISTRTPAPPL_MM_PUR_CQTN_SDS/4 HANA Proc:Central Quotation S/W Dev without Translation
CNTRLQTNDISTR_DI_CENTRALSUPPLIERQUOTATIONTP I_CNTRLSUPPLIERQTANITEMDISTRTPAPPL_MM_PUR_CQTN_SDS/4 HANA Proc:Central Quotation S/W Dev without Translation
CNTRLQTNITM_DI_CENTRALSUPPLIERQUOTATIONTP I_CNTRLSUPPLIERQUOTATIONITEMTPAPPL_MM_PUR_CQTN_SDS/4 HANA Proc:Central Quotation S/W Dev without Translation
CNTRLQTNPRCG_DI_CENTRALSUPPLIERQUOTATIONTP I_CNTRLSUPLRQTANITEMPRICINGTPAPPL_MM_PUR_CQTN_SDS/4 HANA Proc:Central Quotation S/W Dev without Translation
CNTRLQTN_DI_CENTRALSUPPLIERQUOTATIONTP I_CENTRALSUPPLIERQUOTATIONTPAPPL_MM_PUR_CQTN_SDS/4 HANA Proc:Central Quotation S/W Dev without Translation
CNTRLRFQDIST_DI_CENTRALREQUESTFORQUOTATIONTPI_CENTRALRFQITEMDISTRIBUTIONTPAPPL_MM_PUR_CRFQ_SDS/4 HANA Procure:Central RFQ Sofware Dev without Translation
CNTRLRFQDIST_DI_CENTRALREQUESTFORQUOTATIONTPI_CENTRALRFQITEMDISTRIBUTIONTPAPPL_MM_PUR_CRFQ_SDS/4 HANA Procure:Central RFQ Sofware Dev without Translation
CNTRLRFQHDR_DI_CENTRALREQUESTFORQUOTATIONTPI_CENTRALREQUESTFORQUOTATIONTPAPPL_MM_PUR_CRFQ_SDS/4 HANA Procure:Central RFQ Sofware Dev without Translation
CNTRLRFQITEM_DI_CENTRALREQUESTFORQUOTATIONTPI_CENTRALREQFORQUOTATIONITEMTPAPPL_MM_PUR_CRFQ_SDS/4 HANA Procure:Central RFQ Sofware Dev without Translation
MMRENEGHISTORY_DDraft table for entity R_RENEGOTIATIONPRICINGLOGTPAPPL_MM_PUR_CTR_RENEGOTIATIONPurchase Contract Re-Negotiations
MMRENEGHISTORY_DDraft table for entity R_RENEGOTIATIONPRICINGLOGTPAPPL_MM_PUR_CTR_RENEGOTIATIONPurchase Contract Re-Negotiations
MMRENEGOHISTORYRenegotiation History (Renegotiated data from BTP Purchaser)APPL_MM_PUR_CTR_RENEGOTIATIONPurchase Contract Re-Negotiations
MMRENEGOHISTORYRenegotiation History (Renegotiated data from BTP Purchaser)APPL_MM_PUR_CTR_RENEGOTIATIONPurchase Contract Re-Negotiations
MMRENEGOITEMPRCRenegotiation item pricing conditionAPPL_MM_PUR_CTR_RENEGOTIATIONPurchase Contract Re-Negotiations
MMRENEGOITMPRC_DDraft table for entity R_RENEGOTIATIONITEMLISTTPAPPL_MM_PUR_CTR_RENEGOTIATIONPurchase Contract Re-Negotiations
MMPUR_CQTNFOD_DHHeader Data of Follow-on DocumentODATA_MM_PUR_CQTN_MAINTAINS/4 HANA Procure: OData Service for Central Quotation
MMPUR_CQTNFOD_DIItem Data of Follow-on DocumentODATA_MM_PUR_CQTN_MAINTAINS/4 HANA Procure: OData Service for Central Quotation
PURCHASECTRITM_DGenerated draft table for core CDS view: I_PurchaseContractIAPPL_MM_PUR_OAS4HANA Outline agreements
PURCHASECTR_DGenerated draft table for core CDS view: I_PurchaseContractAPPL_MM_PUR_OAS4HANA Outline agreements
CNTRLPCDISTRTP_DI_CENTRALPURCHASECONTRACTTP I_CNTRLPURCONTRDISTRIBUTIONTPAPPL_MM_PUR_OA_CCTRSAP S/4HANA Outline Agreements - Central Purchase Contract
CNTRLPCDISTRTP_DI_CENTRALPURCHASECONTRACTTP I_CNTRLPURCONTRDISTRIBUTIONTPAPPL_MM_PUR_OA_CCTRSAP S/4HANA Outline Agreements - Central Purchase Contract
CNTRLPCDISTRTP_DI_CENTRALPURCHASECONTRACTTP I_CNTRLPURCONTRDISTRIBUTIONTPAPPL_MM_PUR_OA_CCTRSAP S/4HANA Outline Agreements - Central Purchase Contract
CNTRLPCHDISTR_DI_CENTRALPURCHASECONTRACTTP I_CNTRLPURCONTRHDRDISTRTPAPPL_MM_PUR_OA_CCTRSAP S/4HANA Outline Agreements - Central Purchase Contract
CNTRLPCHDISTR_DI_CENTRALPURCHASECONTRACTTP I_CNTRLPURCONTRHDRDISTRTPAPPL_MM_PUR_OA_CCTRSAP S/4HANA Outline Agreements - Central Purchase Contract
CNTRLPCITMTP_DI_CENTRALPURCHASECONTRACTTP I_CNTRLPURCHASECONTRACTITEMTPAPPL_MM_PUR_OA_CCTRSAP S/4HANA Outline Agreements - Central Purchase Contract
CNTRLPCITMTP_DI_CENTRALPURCHASECONTRACTTP I_CNTRLPURCHASECONTRACTITEMTPAPPL_MM_PUR_OA_CCTRSAP S/4HANA Outline Agreements - Central Purchase Contract
CNTRLPCTP_DI_CENTRALPURCHASECONTRACTTP I_CENTRALPURCHASECONTRACTTPAPPL_MM_PUR_OA_CCTRSAP S/4HANA Outline Agreements - Central Purchase Contract
CNTRLPCTP_DI_CENTRALPURCHASECONTRACTTP I_CENTRALPURCHASECONTRACTTPAPPL_MM_PUR_OA_CCTRSAP S/4HANA Outline Agreements - Central Purchase Contract
HIERDISTROVTP_DI_CENTRALPURCHASECONTRACTTP I_CNTRLPURCONTRHIERDISTROVWTPAPPL_MM_PUR_OA_CCTRSAP S/4HANA Outline Agreements - Central Purchase Contract
PURCTR_HDR_DI_PURCHASECONTRACTWD I_PURCHASECONTRACTWDAPPL_MM_PUR_OA_CONS4HANA Outline agreements - Contract
PURCTR_ITM_DI_PURCHASECONTRACTWD I_PURCHASECONTRACTITEMWDAPPL_MM_PUR_OA_CONS4HANA Outline agreements - Contract
MMBSI_PO_SRM_INFDB table for storing additional SRM data related to POMM_P2P_BSI_CCCentral Contract Management
PURCTR_ITM_ACT_DI_PURCHASECONTRACTWD I_PURCTRACCOUNTWDVDM_MM_PUR_CONVDM MM Purchasing: Purchase Contract + Scheduling Agreement
SCHEDAGRMTACCT_DI_SCHEDGAGRMTHDRWITHDRAFT I_SCHEDAGRMTACCTWITHDRAFTAPPL_MM_PUR_OA_SCHDS4HANA Outline agreements: Scheduling Agreement
SCHEDGAGRMTHDR_DI_SCHEDGAGRMTHDRWITHDRAFT I_SCHEDGAGRMTHDRWITHDRAFTAPPL_MM_PUR_OA_SCHDS4HANA Outline agreements: Scheduling Agreement
SCHEDGAGRMTITM_DI_SCHEDGAGRMTHDRWITHDRAFT I_SCHEDGAGRMTITMWITHDRAFTAPPL_MM_PUR_OA_SCHDS4HANA Outline agreements: Scheduling Agreement
EKKO_PO_DHeader - #GENERATED#APPL_MM_PUR_POPurchase Order w/o Draft-based AI
POACCTASSTP_DI_PURCHASEORDERTP I_PURORDACCTASSIGNMENTTPAPPL_MM_PUR_PO_AIPackage for Purchase Order generated by AI
POPRICINGTP_DI_PURCHASEORDERTP I_PURORDPRICINGELEMENTTPAPPL_MM_PUR_PO_AIPackage for Purchase Order generated by AI
POPRICINGTP_DI_PURCHASEORDERTP I_PURORDPRICINGELEMENTTPAPPL_MM_PUR_PO_AIPackage for Purchase Order generated by AI
POPRICINGTP_DI_PURCHASEORDERTP I_PURORDPRICINGELEMENTTPAPPL_MM_PUR_PO_AIPackage for Purchase Order generated by AI
POPRICINGTP_DI_PURCHASEORDERTP I_PURORDPRICINGELEMENTTPAPPL_MM_PUR_PO_AIPackage for Purchase Order generated by AI
PURORDITMTP_DI_PURCHASEORDERTP I_PURCHASEORDERITEMTPAPPL_MM_PUR_PO_AIPackage for Purchase Order generated by AI
PURORDTP_DI_PURCHASEORDERTP I_PURCHASEORDERTPAPPL_MM_PUR_PO_AIPackage for Purchase Order generated by AI
EKBEZH_MA_LDRemoved PO History at Account Assignment + Ledger LevelME_POPurchase Order specific objects
EKBEZ_MA_LDPurchase Order History at Account Assignment + Ledger LevelME_POPurchase Order specific objects
USERDEF_ITM_DI_USERDEFAULTSETTINGWD I_USERDEFAULTSETTINGITEMWDAPPL_MM_COMP_EMPL_SETTINGSEmployee/User Personalisation
USERSETTINGITE_DGenerated draft table for core CDS view: I_UserDefaultSettinAPPL_MM_COMP_EMPL_SETTINGSEmployee/User Personalisation
USER_PERS_DATAAdvanced user setting detailsAPPL_MM_COMP_EMPL_SETTINGSEmployee/User Personalisation
OCIITM_PROP_RLPOInternal catalog proposal related purchase ordersAPPL_MM_PUR_REQ_MLMachine Learning Objects for SSP PR
OCIITM_PROP_SUPPSupplier recommendations for internal catalog proposalsAPPL_MM_PUR_REQ_MLMachine Learning Objects for SSP PR
DRAFT_PR_ITEMSSP Requisition ItemAPPL_MM_PUR_REQS4HANA Artifacts for SSP PR
EBAN_SSP_ITM_DRequisition Item Draft for SSP , Draft Version 2APPL_MM_PUR_REQS4HANA Artifacts for SSP PR
IWI_PRHDRITMDT_DI_PURCHASEREQNWORKITEMTP I_WRKITMPURREQNHDRITEMDETAILTPAPPL_MM_PUR_PR_APPRVL_COMPLS4HANA Artefacts for PR Approval Completion
IWI_PRHDRITM_DI_WORKITEMPURREQNHDRITEMTP I_WORKITEMPURREQNHDRITEMTPAPPL_MM_PUR_PR_APPRVL_COMPLS4HANA Artefacts for PR Approval Completion
IWI_PRITMDET_DI_PURCHASEREQNWORKITEMTP I_WORKITEMPURREQNITEMDETAILTPAPPL_MM_PUR_PR_APPRVL_COMPLS4HANA Artefacts for PR Approval Completion
MMPUR_PR_D_POHDHeader Draft Database Table for Purchase OrderAPPL_MM_PUR_PRsSuite Development Purchase Requisition
MMPUR_PR_D_POITItem Node for Purchase Order DraftAPPL_MM_PUR_PRsSuite Development Purchase Requisition
PRACCTWI_DI_PURCHASEREQNWORKITEMTP I_PURREQNACCTASSGMTWRKITMTPAPPL_MM_PUR_PR_APPRVL_COMPLS4HANA Artefacts for PR Approval Completion
PRHIACCTWI_DI_PURCHASEREQNWORKITEMTP I_PURREQNHDRITMACASWRKITMTPAPPL_MM_PUR_PR_APPRVL_COMPLS4HANA Artefacts for PR Approval Completion
PURREQNACCT_DT_PURCHASEREQN T_PURCHASEREQNACCTASSGMTAPPL_MM_PUR_REQ_PROFNLS4HANA Artefacts : Manage Professional Purchase Requisition
PURREQNITM_DT_PURCHASEREQN T_PURCHASEREQNITEMAPPL_MM_PUR_REQ_PROFNLS4HANA Artefacts : Manage Professional Purchase Requisition
SSPREQ_ITM_ACC_DI_PURCHASEREQUISITION_WD I_PURREQNACCASSIGNMENT_WD GenAPPL_MM_PUR_REQS4HANA Artifacts for SSP PR
SSPREQ_ITM_DI_PURCHASEREQUISITION_WD I_PURCHASEREQUISITIONITEM_WDAPPL_MM_PUR_REQS4HANA Artifacts for SSP PR
SSPREQ_ITM_DI_PURCHASEREQUISITION_WD I_PURCHASEREQUISITIONITEM_WDAPPL_MM_PUR_REQS4HANA Artifacts for SSP PR
MMPUR_CAT_CRCUSTSettings for Cross-Catalog SearchVDM_MM_PUR_CATALOGCatalog core CDS views
MMPUR_CAT_ITM Catalog items stored for searchVDM_MM_PUR_CATALOGCatalog core CDS views
MMPUR_CAT_MY_FAVPersonal MarkersVDM_MM_PUR_CATALOGCatalog core CDS views
MMQTNCOMP_DI_RFQCOMPARETP I_SUPPLIERQUOTATIONCOMPARETPAPPL_MM_PUR_QTN_COMPARE_SDQTN Compare Software Development without Translation
MMQTNENH_DI_SUPLRQUOTATIONENHWD I_SUPLRQUOTATIONENHWDAPPL_MM_PUR_QTN_SDQuotation Software Development without Translation
MMQTNITEMENH_DI_SUPLRQUOTATIONENHWD I_SUPLRQUOTATIONITEMENHWDAPPL_MM_PUR_QTN_SDQuotation Software Development without Translation
MMQTNITMCOMP_DI_RFQCOMPARETP I_SUPLRQUOTATIONITEMCOMPARETPAPPL_MM_PUR_QTN_COMPARE_SDQTN Compare Software Development without Translation
MMQTNPRICING_DI_SUPLRQUOTATIONENHWD I_QTNPRICINGELEMENTWDAPPL_MM_PUR_QTN_SDQuotation Software Development without Translation
MMRFQENH_DI_REQUESTFORQUOTATIONENHWD I_REQUESTFORQUOTATIONENHWDAPPL_MM_PUR_RFQ_SDRFQ Software Development without Translation
EINA_EINE_D#GENERATED#APPL_MM_PUR_SOSsSuite Development Source of Supply
/SRMERP/D_SC_ITMShopping Cart Item/SRMERP/OL_BO_SCBPO Shopping Cart
CTLGITM_DRAFTI_CATALOGITEMMNGTP I_CATALOGITEMMNGTPODATA_MM_PUR_CATALOGITEMS_MNGOData Package for Manage Catalog Items App
MMPUR_SES_HEADERService Entry Sheet HeaderAPPL_MM_PUR_SES_TRService Entry Sheet - translation relevant objects
SESPRCGELMNTTP_DI_SERVICEENTRYSHEETTP I_SESPRICINGELEMENTTPAPPL_MM_PUR_SES_TRService Entry Sheet - translation relevant objects
SESPRCGELMNTTP_DI_SERVICEENTRYSHEETTP I_SESPRICINGELEMENTTPAPPL_MM_PUR_SES_TRService Entry Sheet - translation relevant objects
SESPRCGELMNTTP_DI_SERVICEENTRYSHEETTP I_SESPRICINGELEMENTTPAPPL_MM_PUR_SES_TRService Entry Sheet - translation relevant objects
SESPRCGELMNTTP_DI_SERVICEENTRYSHEETTP I_SESPRICINGELEMENTTPAPPL_MM_PUR_SES_TRService Entry Sheet - translation relevant objects
SRVCENTRSHTACC_DI_SERVICEENTRYSHEETTP I_SESACCOUNTASSIGNMENTTPAPPL_MM_PUR_SES_TRService Entry Sheet - translation relevant objects
SRVCENTRSHTITM_DI_SERVICEENTRYSHEETTP I_SERVICEENTRYSHEETITEMTPAPPL_MM_PUR_SES_TRService Entry Sheet - translation relevant objects
SRVCENTRSHTITM_DI_SERVICEENTRYSHEETTP I_SERVICEENTRYSHEETITEMTPAPPL_MM_PUR_SES_TRService Entry Sheet - translation relevant objects
SRVCENTRSHT_DI_SERVICEENTRYSHEETTP I_SERVICEENTRYSHEETTPAPPL_MM_PUR_SES_TRService Entry Sheet - translation relevant objects
SRVCENTRSHT_DI_SERVICEENTRYSHEETTP I_SERVICEENTRYSHEETTPAPPL_MM_PUR_SES_TRService Entry Sheet - translation relevant objects
INFRECWITHORG_DGenerated draft table for core CDS view: I_PurgInfoRecordWitAPPL_MM_PUR_INFORECORDsSuite Development Inforecord App
INFREC_HDR_DI_PURGINFORECORDWWITHDRAFT I_PURGINFORECORDWWITHDRAFTAPPL_MM_PUR_INFORECORD_TRsSuite Development Inforecord App translation relevant objec
ESLHService Package Header DataMLR/3 External Services Management
ESSRService Entry Sheet Header DataMLR/3 External Services Management
ESUHExt. Services Management: Unpl. Service Limits: Header DataMLR/3 External Services Management
TMP_SPECModel Service SpecificationsMLR/3 External Services Management
/SMERP/STG_PM013Data staging LAM - Equipment complex table/SMERP/E5_MDO_PMMDO Framework - Plant Maintenance
/SMERP/STG_PM014Data staging LAM - Functional Location complex table/SMERP/E5_MDO_PMMDO Framework - Plant Maintenance
/SMERP/STG_PM001Data staging - Equipment complex table/SMERP/MDO_PMMDO Framework - Plant Maintenance
/SMERP/STG_PM002Data staging - Functional Location complex table/SMERP/MDO_PMMDO Framework - Plant Maintenance
/SMERP/STG_PM003Data staging - Equipment List Set - Hdr - complex tab/SMERP/MDO_PMMDO Framework - Plant Maintenance
/SMERP/STG_PM008Data staging - Functional Loc. List Set - Hdr - complex tab/SMERP/MDO_PMMDO Framework - Plant Maintenance
VMP_CHNG_MGMNTVEMP Change management for Automatic HandoverVEP_HFE_MODELHandover from Engineering Model Objects
VMP_CHNG_MGMNTVEMP Change management for Automatic HandoverVEP_HFE_MODELHandover from Engineering Model Objects
MAINTORDOPER_DI_MAINTORDERTP I_MAINTORDEROPERATIONTPODATA_EAM_ORD_MANOData Services for EAM: Manage Order
MAINTORDSOP_DI_MAINTORDERTP I_MAINTORDERSUBOPERATIONTPODATA_EAM_ORD_MANOData Services for EAM: Manage Order
TECHNICALOBJEC_DI_TECHNICALOBJECTTP I_TECHNICALOBJECTTPODATA_EAM_TECHOBJ_MANOData Services for EAM: Manage Technical Object
CFG_EAM_IE01_CRCBC - C-Table for eCATT /SMB10/IE01_O004_P26IEQMApplication Develoment R/3 Equipment Management
EQUIEquipment master dataIEQMApplication Develoment R/3 Equipment Management
IFLOTFunctional Location (Table)ILOMApplication Development R/3 Location Management
IFLOT_VSFunctional Location (Version Table)ILOMApplication Development R/3 Location Management
MCIPMISPMIS: Master data characteristics for PMIS before imageMCIR/3 appl. development: Plant Maintenance Information System
S061Location and planningMCIR/3 appl. development: Plant Maintenance Information System
S061ES061 - Structural InformationMCIR/3 appl. development: Plant Maintenance Information System
S062Object class and manufacturerMCIR/3 appl. development: Plant Maintenance Information System
S062ES062 - Structural InformationMCIR/3 appl. development: Plant Maintenance Information System
S065Object statisticsMCIR/3 appl. development: Plant Maintenance Information System
S065ES065 - Structural InformationMCIR/3 appl. development: Plant Maintenance Information System
S114MCIR/3 appl. development: Plant Maintenance Information System
S114EMCIR/3 appl. development: Plant Maintenance Information System
S115Cost EvaluationMCIR/3 appl. development: Plant Maintenance Information System
S115ES115 - Structural InformationMCIR/3 appl. development: Plant Maintenance Information System
MPOSMaintenance itemIPRMApplication Development R/3 Preventive Maintenance
HIMAPM order history - materialsIWO2Application Development R/3 Plant Maintenance Order History
HIVGPM order history - operationsIWO2Application Development R/3 Plant Maintenance Order History
QMELQuality NotificationIWOCApplication Development R/3 Work Order Cycle
AUFMGoods movements for orderIWO1Appl. Development R/3 Plant Maintenance Order Processing
PLPOTask list - operation/activityCPR/3 Application Development: PP Task Lists
CRTE_ROUTING_CBCX4: For eCATT /SMB99/CA01_O001_J01PPH_MFG_MD_RTGPP Routing MasterData
DDSTKPRPSLTP_DI_STOCKLEVELPROPOSALTP I_STOCKLEVELPROPOSALTPPPH_DD_STLMDD: Buffer Level Management
PPH_DD_PRODUCTDemand Driven Extended Product DetailsPPH_DD_STLMDD: Buffer Level Management
PPH_DD_STPR_HDRStock Level Proposal HeaderPPH_DD_STLMDD: Buffer Level Management
STCK_WORKLISTAccepted solutions for Issue Stock ChampionODATA_PP_SCStock Champion
MCCOMPVVersions: Material ComponentsMCFR/3 application development: Shop Floor Information System
MCKALKVVersions: Cost ItemizationMCFR/3 application development: Shop Floor Information System
MCKALKVVersions: Cost ItemizationMCFR/3 application development: Shop Floor Information System
MCKALKWVersions: Cost ItemizationMCFR/3 application development: Shop Floor Information System
MCKALKWVersions: Cost ItemizationMCFR/3 application development: Shop Floor Information System
MCSFISR/2 SFIS Data: OldMCFR/3 application development: Shop Floor Information System
MCSFISR/2 SFIS Data: OldMCFR/3 application development: Shop Floor Information System
MRP_REQ_NOTERequests and Notes for MRP CockpitPPH_DDICPP on HANA: Dictionary objects
CFB_VERID_MRPRelease/Lock Production Version for Mat. Req. PlanningCFB_GENERALCFB General (DDIC)
CFB_VERID_MRPRelease/Lock Production Version for Mat. Req. PlanningCFB_GENERALCFB General (DDIC)
CFB_VERID_MRPRelease/Lock Production Version for Mat. Req. PlanningCFB_GENERALCFB General (DDIC)
COMPMOVEGoods Movement of ComponentsMD04Repetitive Manufacturing
AFVCOperation within an orderCOApplication Development ERP PP Production Orders
AFFWGoods Movements with Errors from ConfirmationsCORUR/3 Application development: PP Confirmations
T440PProfiles for Function Module PROGNOSE_DIALOGMCP2R/3 application development: Sales & Operations Planning
RPM_PP_PRIORITYRPM : Porfolio prioritization ScenarioRPM_PORTFOLIOPortfolio objects
RPM_PROJECT_COControlling Information about a projectRPM_PROJECTRPM Application Object Project
RPM_SCENARIO_FINRPM : Scenario financial dataRPM_SCENARIOWhat-If Scenario Package
RPM_FIDATAFinancial InformationRPM_INTEGRATION_FICORPM FI/CO Integration
RPM_FIDATAFinancial InformationRPM_INTEGRATION_FICORPM FI/CO Integration
DPR_DASHBOARDDashboard Data for ProjectDEVELOPMENT_PROJECTS_EVEEvaluations / Dashboard / Alerts
TPI02Interest Calculation Profile and Interest IndicatorKAPIInterest calc./mass processing
TZIN3Interest Document: Currency Type SegmentKAPIInterest calc./mass processing
AD01DLISFDI Flow: Totals FlowAD01DI Processor (Resource-Related Billing/Sales Pricing)
AD01WIP_REVWIP DetailsAD01DI Processor (Resource-Related Billing/Sales Pricing)
KFPEWClearing Amounts in Various CurrenciesKFPRTransfer Prices for Individual Projects
KFPPWDocument Item Amounts in Different CurrenciesKFPRTransfer Prices for Individual Projects
VSAFVC_CNVersion: Operation in orderCNVSR/3 Application development: Version Management
VSEBAN_CNVersion: Purchase requisitionCNVSR/3 Application development: Version Management
VSRESB_CNVersion: Reservation/Dependent requirementsCNVSR/3 Application development: Version Management
TCN41Network DefaultsCN_NET_OPROperative Network
TCBPGantt chart settingsCN_PPT_GRAFIKProject Planning Board
TCA41Default values for standard networks and profilesCN_NET_STDStandard network
KBLE_KMAN_DRAFTR_EARMARKEDFUNDSDOCUMENTTP R_EMRKDFNDSDOCITMPROCGITEMTPODATA_PSM_S4C_EARMARKED_FUNDSPSM: ODATA for Earmarked funds
FMPPFUNDItems for Partial Payment by Fund ProcessFMPP_CORE_EPartial Payment by Split characteristic of new GL
FMSPLIT_SPLITDistributions for Rule-Based Account DistributionsFM_SPLIT_CORE_ECore objects for FM spliting tool. To be used in EA
FMFCTRFunds Center Master RecordFMMD_COREFunds Management: Master Data Core Objects
GMSPONSORSponsor MasterPSM_S4C_GM_MDPublic Sector S4C Grantee Management Master Data
QPACInspection catalog codes for selected setsQAQM master data
S402Business entitiesFVVIR/3 appl.dev. for Financial Assets Management: Real estate
S402Business entitiesFVVIR/3 appl.dev. for Financial Assets Management: Real estate
S404PropertiesFVVIR/3 appl.dev. for Financial Assets Management: Real estate
S405BuildingFVVIR/3 appl.dev. for Financial Assets Management: Real estate
S406Rental unitsFVVIR/3 appl.dev. for Financial Assets Management: Real estate
S407Rental agreementsFVVIR/3 appl.dev. for Financial Assets Management: Real estate
S408Land registersFVVIR/3 appl.dev. for Financial Assets Management: Real estate
TIPALRE: Tenancy Law/Country-Dependent Parameters for Rent Adj.FVVIR/3 appl.dev. for Financial Assets Management: Real estate
TIV20Rep.list of rents master dataFVVIR/3 appl.dev. for Financial Assets Management: Real estate
TIVLICPAICI Payment instalmentFVVIIT
TIVLIRVAIRE VariablesFVVIIT
VIAK22Heat.oil supplyFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIAKBKPFDocument Header from Service Charge Settlement for InterfaceFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIBEBECorrection items for input tax treatmentFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VICNSCSReal Estate Contract: Service Charge KeyFVVICNZApplic.Dev. R/3 Real Estate - Gen.Contract - Enhancements
VILICICI Historical DataFVVIIT
VILIDICI Historical Data of D-BuildingFVVIIT
VILIRIRE Historical dataFVVIIT
VIMI02Fixtures and Fittings Characteristics of a Rental UnitFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIMI07Reported Sales for Sales-Based Lease-OutFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIMI12Rental requests in an applicationFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIMI17RE: Adjustment Run HeaderFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIMI27Modernization MeasureFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIMI41Expert opinion on rent adjustmentFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIMIIHInvoice HeaderFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIOB01Business entitiesFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIRPS405BuildingFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIRPS406Rental unitsFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIRPS407Rental agreementsFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VITAXDTax Shares per Real Estate Account AssignmentFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIVSTBDocument reference for input tax treatmentFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIVW01Management contract: General dataFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIVW08Events for management contractsFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIVW09Postings for management costs settlementsFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VIVW10Interface prop.man.settlement/transfer advance paymentsFVVIR/3 appl.dev. for Financial Assets Management: Real estate
VISCS_COSTSOBSOLETE: Determined Costs (Replaced by VISCSCOSTS)RE_XXRE: Obsolete Objects (Do Not Delete!!!)
VISCS_RECEIVEOBSOLETE: Receivables (Replaced by VISCRECEIVABLE)RE_XXRE: Obsolete Objects (Do Not Delete!!!)
TIVITTCEXECREGTrivial Amount LimitRE_IT_TCRE: Input Tax Correction
TIVITTCMALObsoleteRE_IT_TCRE: Input Tax Correction
VIITTCCorrection ObjectRE_IT_TCRE: Input Tax Correction
VIITTCBASEBasis for Input Tax CorrectionRE_IT_TCRE: Input Tax Correction
VIITTCCALCRESInput Tax Correction: Line ItemRE_IT_TCRE: Input Tax Correction
TIVFVORRE_MI_LU
TIVHOHBKID5RE_MI_HO
VIAKHOPORE_MI_HO
VIAKHOWPRE_MI_HO
VIEINHWJRE_MI_LU
VIEINHWJRE_MI_LU
VIEINHWJRE_MI_LU
VIEINHWJRE_MI_LU
VIEINHWJRE_MI_LU
VIEINHWJRE_MI_LU
VIEINHWJRE_MI_LU
VIEINHWJRE_MI_LU
VIEINHWJRE_MI_LU
VIEINHWJRE_MI_LU
VIEINHWJRE_MI_LU
VIEINHWJRE_MI_LU
VIEINHWJRE_MI_LU
VIEINHWJRE_MI_LU
VIEINHWJRE_MI_LU
VIEINHWJRE_MI_LU
VIFANLARE_MI_LU
VIXCOTDOCCOA, Distribution of VAT, DocumentsRE_XC_MM_ATRE: XC - Mandate Management - Austria
VIXCOTDSCOA, Distribution of VATRE_XC_MM_ATRE: XC - Mandate Management - Austria
TIVXCITIBPARAIB Stamp tax parameterRE_XC_RA_IT
VIXCITCADAOTemporary architectural object dataRE_XC_RA_IT
VIXCITCADROTemporary rental object dataRE_XC_RA_IT
VIXCITCADROTemporary rental object dataRE_XC_RA_IT
VIXCITICIDATAICI master dataRE_XC_RA_IT
VIXCITICIDBUDICI parameter for D-BuildingRE_XC_RA_IT
VIXCITIRE2DATAIRE2 Master DataRE_XC_RA_IT
VIXCITIREDATAIRE master dataRE_XC_RA_IT
VIXCITTASICALCTASI calculation dataRE_XC_RA_IT
VIXCITTASIDATATASI master dataRE_XC_RA_IT
VIXCMSCOELEMNTItem Data: Cost ElementsRE_XC_RA_MSRE: XC - Main Rent Statement Austria AT
VIXCMSHEADERHeader DataRE_XC_RA_MSRE: XC - Main Rent Statement Austria AT
VIXCMSSINGLDOCItem Data: Single DocumentRE_XC_RA_MSRE: XC - Main Rent Statement Austria AT
VIXCFCFSFuel MovementRE_XC_SC_FCRE: XC - Fuel Consumption
TIVAJEPCRTDTime-Dependent Calculation Formula for Expense ItemRE_AJ_BDRE: Adjustment Master Data
TIVAJEXPPOSExpense ItemRE_AJ_BDRE: Adjustment Master Data
VIAJATAdjustment MeasureRE_AJ_BDRE: Adjustment Master Data
VIAJRECCOMPAdjustment Record COMPRE_AJ_MERE: Adjustment Methods
VIAJRECCOMPOBJAdjustment Record COMPOBJRE_AJ_MERE: Adjustment Methods
VIAJRECCOMPOBJAdjustment Record COMPOBJRE_AJ_MERE: Adjustment Methods
VIAJRECRLRAFFAdjustment Record RLRAFFRE_AJ_MERE: Adjustment Methods
VIBDBEBusiness EntityRE_BD_BERE: Business Entity (Master Data)
VIBDBUBuildingRE_BD_BURE: Building (Master Data)
VIBDBUBuildingRE_BD_BURE: Building (Master Data)
VIBDCHARACTFixtures/FittingsRE_BD_CTRE: Fixtures and Fittings Characteristics
VIBDPRLandRE_BD_PRRE: Property Master Data
VIBDPRLandRE_BD_PRRE: Property Master Data
VIBDRORental ObjectRE_BD_RORE: Rental Object Master Data
VIBDRORental ObjectRE_BD_RORE: Rental Object Master Data
VIITTAXDSBASETax Document Item to Be Broken Down (VIITTAXDSBASE)RE_IT_DSRE: Input Tax Distribution
VIITTAXDSITEMDistributed Tax Document Item (VIITTAXDSITEM)RE_IT_DSRE: Input Tax Distribution
VIXCRDSVREINVRDSV Digital Signature (RE-FX)GLO_REFX_RDSVRegulatory Document and Signature Validation (RE-FX)
REFXCN_STATESale Satement DataGLO_REFX_POS2_CN_DDICReal Estate POS Integration for China enhanced - DDIC
REFXCN_IDOCREFX POS IDOC Inbound dataGLO_REFX_POS_CN_DDICReal Estate POS Integration for China - DDIC
REFXCN_IDOCTABREFX POS IDOC Inbound dataGLO_REFX_POS_CN_DDICReal Estate POS Integration for China - DDIC
/CEERE/RIZENIFUProperty tax control - tax offices/CEERE/DANNEM
/CEERE/SDANProperty tax return - sheets/CEERE/DANNEM
/CEERE/SDANAProperty tax return - items/CEERE/DANNEM
/CEERE/SDANFUProperty tax return - section IV/CEERE/DANNEM
/CEERE/SDANPProperty tax - master/CEERE/DANNEM
VIXCSKTAXRET_HProperty Tax Return SK - Cover, Section VGLO_REFX_SK
VIXCSKTAXRET_PProperty Tax Return SK - Items - Sections II,III,IVGLO_REFX_SK
VIXCSKTAXRET_SProperty Tax Return SK - Sheets - Sections II,III,IVGLO_REFX_SK
VILMNAVALNotice of Assessment: Annual ValuesRE_LM_NARE: Notice of Assessment
TIVEXFIDUNNBPDunning Parameters per BP RoleRE_EX_FIRE: Financials
TIVRAOPACTSettings for Posting ActivityRE_RA_OPRE: One-Time Posting
VIRAADVPAYOBSOLETE: Advance PaymentRE_RA_APRE: Advance Payment
VIRAADVPAYEXTAdvance Payment - Legacy Data TransferRE_RA_APRE: Advance Payment
VIRAADVPAYPROCAdvance Payments per SettlementRE_RA_APRE: Advance Payment
VIRAADVPAYSPLITSplit Advance PaymentsRE_RA_APRE: Advance Payment
VIRADOCITEMRE Document ItemRE_RA_CARE: Cross Application Rental Accounting
VIRAINVRE Invoice HeaderRE_RA_IVRE: Invoice for Rent
VISCAJROAdjustment Record SCSE per Rental ObjectRE_SC_AJSCS: Adjustment
VISCAJROSUAdjustment Record SCSE per RO and SURE_SC_AJSCS: Adjustment
VISCCNPARTSettlement Participation for Service Charge SettlementRE_SC_SPSCS: Settlement Participation
VISCCOSTDISTCost DistributionRE_SC_DCSCS: Distribute Costs
VISCCOSTSEXTCosts per Object - Legacy Data TransferRE_SC_GCSCS: Get Costs
VISCDTAPEData of D-TapeRE_SC_TASCS: Tapes for External Settlement Companies
VISCITADJUSTInput tax adjustmentRE_SC_ITSCS: Input Tax Adjustment
VISCRECEIVABLEReceivables from SettlementRE_SC_CRSCS: Credit/Receivables
VISCSCOSTSDetermined CostsRE_SC_GCSCS: Get Costs
VISCS_MSU_RESTDistribution of Master SU to Remaining ObjectsRE_SC_SHSCS: Settlement Hierarchy
VISCS_MSU_SUDistribution of Master SU to Participating SUsRE_SC_SHSCS: Settlement Hierarchy
VISCS_RO_CNCosts and Measurement Amounts for REC + RO (Lease-Out View)RE_SC_SHSCS: Settlement Hierarchy
VISCS_SU_ROSum of All Costs and Measurement Amounts for a Rental ObjectRE_SC_SHSCS: Settlement Hierarchy
VISCS_SU_SUMSum of All Costs and Measurement Amounts for Settlment UnitRE_SC_SHSCS: Settlement Hierarchy
VISRCALCDETAILResults of Sales Grading CalculationRE_SR_CLRE: Calculation
VISRCALCSBInterim ResultRE_SR_CLRE: Calculation
VISRCALCSUMCalculation Results per Sales RuleRE_SR_CLRE: Calculation
VISRMODIRESULTChanged Sales-Based Settlement ResultsRE_SR_MORE: Processing of Sales-Based Rent
VISRREPORTSales ReportRE_SR_RPRE: Sales Reports
VISRTMMSBSBAssignment of a Sales Rule to a Peak Sales RuleRE_SR_TMRE: Terms - Sales Agreement
VISRTMSBRPAssignment of a Reporting Rule to a Sales RuleRE_SR_TMRE: Terms - Sales Agreement
VISRTMSBRPIAssignment of Reporting Rule to Sales Rule (Grading)RE_SR_TMRE: Terms - Sales Agreement
VISRTMSB_DDraft table for entity R_RECONTRSALESRULETERMTPVDM_RE_SRRE: Virtual Data Model for Sales-Based Rent (VDM)
TIVBE44REITRE: Input Tax Treatment
VIBEBASEREITRE: Input Tax Treatment
VIBEITEMREITRE: Input Tax Treatment
VIRALSRHDStatistics - Returned Debit Memos in RE: Header DataRERARE: Rental Accounting
/LIME/PI_STOCK_PStock Population/LIME/PI_SAMPLESample-Based Physical Inventory Adapter
/SCWM/T_VAL_SPLTSplit Valuation Data/SCWM/BATCH_MANAGEMENTBatch Management
/SCWM/T_VALUATEValuation Data for Physical Inventory/SCWM/PI_APPLPhysical Inventory - Function Package
CUST_EXP_KOMVDRFDraft for Pricing Communications-Condition Record (KOMV)ODATA_SD_SDOC_CUSTPRICESD OData package for Sales Doc with Customer Expected Price
FPLABilling PlanVZApplication development R/3 RV central functions
FPLTBilling Plan: DatesVZApplication development R/3 RV central functions
KONVConditions (Obsolete - replaced by PRCD_ELEMENTS)VF_PRC_CORECentral Pricing Routines
PRCD_ELEMENTSPricing ElementsVF_PRC_DBDB Layer for Pricing Result
PRCD_ELEM_DRAFTPricing Elements DraftVF_PRC_DBDB Layer for Pricing Result
/BEV1/EMLGBSDCustomer Empties Stock per Month/BEV1/EMEmpties Management
/BEV1/EMLGFADEmpties Movement - Customer Billing Status/BEV1/EMEmpties Management
/BEV1/EMLGKTOEmpties Account/BEV1/EMEmpties Management
FPLTCPayment cards: Transaction data - SDVFCApplication development R/3 billing docs.: Payment cards
T665FSD Self-Billing Procedures: Tolerance Limits, AbsoluteAmountVASBApplication Development R/3 Sales / Self-Billing Process
PRSD_DLIEF_EXTDLI Document Flow ExtensionPROF_SERV_B_SFWS_SC
VBREVACRevenue Recognition: Compression of FI Revenue PostingsVFER/3 billing document appl. development: Revenue recognition
VBREVERevenue Recognition: Revenue Recognition LinesVFER/3 billing document appl. development: Revenue recognition
VBREVKRevenue Recognition: Control LinesVFER/3 billing document appl. development: Revenue recognition
VBREVRRevenue Recognition: Reference Document LinesVFER/3 billing document appl. development: Revenue recognition
AKKBDocumentary Payment Guarantee: Financial Doc. - Bank DataVEIApplication development R/3 foreign trade
ECCNLegal Control: Foreign PercentagesVEIApplication development R/3 foreign trade
EMBKLegal Control: License Master - Header DataVEIApplication development R/3 foreign trade
MAPEWGMaterial master: Preference determination: Cross-plantVEIApplication development R/3 foreign trade
MMPREF_PRO_01Logging table for archiving object MMPREFVEIApplication development R/3 foreign trade
MMPREF_PRO_01_BLog table - Preference - Information from rulesVEIApplication development R/3 foreign trade
MMPREF_PRO_03Log table - Component - InformationVEIApplication development R/3 foreign trade
MMPREK_PRO_01Log table for archiving object MMPREKVEIApplication development R/3 foreign trade
MMPREK_PRO_01_BLog table - Preference - Info from ruleVEIApplication development R/3 foreign trade
MMPREK_PRO_03Log table - Component - InformationVEIApplication development R/3 foreign trade
MMPREW_PRO_01Log table for archiving object MMPREWVEIApplication development R/3 foreign trade
MMPREW_PRO_01_BPreference CPG: Log - Information from ruleVEIApplication development R/3 foreign trade
MMPREW_PRO_03Preference CPG: Log components - InformationVEIApplication development R/3 foreign trade
VEIAVINTRASTAT Receipt/DispatchVEIApplication development R/3 foreign trade
VEIAVINTRASTAT Receipt/DispatchVEIApplication development R/3 foreign trade
VEIAVINTRASTAT Receipt/DispatchVEIApplication development R/3 foreign trade
VEKACKOBRA (C Record) ExportVEIApplication development R/3 foreign trade
VEKACKOBRA (C Record) ExportVEIApplication development R/3 foreign trade
VESEDSED / AERP ExportVEIApplication development R/3 foreign trade
VESEDSED / AERP ExportVEIApplication development R/3 foreign trade
VEXAVEXTRASTAT / VAR Export/ImportVEIApplication development R/3 foreign trade
VEXAVEXTRASTAT / VAR Export/ImportVEIApplication development R/3 foreign trade
KONAAgreementsVKONApplication development Conditions
/SCMB/HRP5561DB Table for Infotype 5561/SCMB/ORGUNIT_CUSTOrganizational Unit
CTE_D_PY_ATTRPayroll Document AttributesCTE_HCM_PAYROLL_IMPPayroll Integration
CTE_D_PY_HISTtable for posting documents for older revision numbersCTE_HCM_PAYROLL_IMPPayroll Integration
UABATIMPORTVARVariants for Batch Import, PDCE, EhP4UA_SFWS_UI_PDCE_EHP4SEM-BW: UI Enhancements in ERP 6.0 EhP 4
/EACA/TPMLIDOC2Source Document PM Line Items - Key Figures with Values/EACA/PROFITABILITY_MANAGEMENTE-Accounting: Profitability Management
HRP1818DB Table for Infotype 1818FOPC_HR_ORGHR-Specific
UBC_TB_CURMax./Min. Amounts per User and CurrencyUBC_CSPFSCM Biller Consolidator-Prototype for CSP with Acct.Assgnmt
UBC_TB_INVHBill (Header)UBC_CSPFSCM Biller Consolidator-Prototype for CSP with Acct.Assgnmt
ACCLEGENT0CLegal EntityFINB_LEGENTLegal Entity
ACCSYS04Customizing for Accounting SystemFINB_ACCOUNTING_SYSTEMAccounting System
UMR_EX100RMS: Measure Deviations for RisksUMRCPM: Risk Management
UMR_EX110RMS: Measure TargetsUMRCPM: Risk Management
UMR_RI140RMS: Risk-Reducing Activities (Master)UMRCPM: Risk Management
J_7LC58REA Customizing: Posting of Accruals CorrectionsJ7LRREA Core Functionality
LMD_COM_PC_BDPosting Control for Bank DepositLMD_COM_CUSTLast Mile Distribution Customizing
LMD_COM_PC_CAPPosting Control for Customer Account PostingLMD_COM_CUSTLast Mile Distribution Customizing
LMD_COM_PC_RPPosting Control for Incoming Driver PaymentsLMD_COM_CUSTLast Mile Distribution Customizing
CRMC_IST_QUICKAdjustment Request Quick SearchCRM_ADJREQ_UICRM 5.1 Adjustment Requests UI
CRMC_FICA_REFILLFI-CA Refill Data MaintenanceCRM_FICA_CUST04CRM FI-CA Integration Customizing Part II
CRMD_EDR_PAYM_DPayment data of EDRsCRM_EDRCRM 5.1 Telco : Package for FSCM -Line Item Dispute EDR
CRMD_ISU_POCPUtilities Price Object ComponentsCRM_IU_PRC_BTXPrice Object One Order Extension
CRMC_IU_FLDMAPAttributes for Simplified ConfigurationCRM_IU_IC_6X_SI_CUSTUtilities: IC WebClient Sales Integration - Customizing
CRMC_ISX_PP_VTARules for Prepaid Amount FieldsCRM_ISX_BTX_PAYMENTConvergent Customer Care - BTX: Payment Processing
/GSINS/CLAIMLOSSCLAIM_LOSS/GSINS/MTPLFS-CM Russia: MTPL Reports and changes
/GSINS/CLAIM_REMClaim_rem/GSINS/MTPLFS-CM Russia: MTPL Reports and changes
/GSINS/ER_ETL_FIInsurance ETL Customizing Table/GSINS/REUFS-CM Russia: Reusable objects for all packages
/GSINS/OLR_PTERMOpen Loss Reserves: Pre-Term Terminations /Insurance Premium/GSINS/OLRFS-CM Russia: Open Loss Reserves
/GSINS/OLR_RCLCDOpen Loss Reserves: Reserve Calculation (Items)/GSINS/OLRFS-CM Russia: Open Loss Reserves
/LIME/PN_ITEMTable to Save Prima Nota Item Data/LIME/PLT_COREPlatform - Core
/LIME/COLL_APSCollection for Planning System/LIME/RFC_CORECore Package of the RFC Interface
/LIME/COLL_BWCollection for Business Warehouse/LIME/RFC_CORECore Package of the RFC Interface
/LIME/COLL_FINCollection for Financial System/LIME/RFC_CORECore Package of the RFC Interface
/LIME/COLL_INVCollection for Inventory System/LIME/RFC_CORECore Package of the RFC Interface
/LIME/COLL_LEGCollection for External System/LIME/RFC_CORECore Package of the RFC Interface
/LIME/COLL_MMIMCollection for R/3 Inventory Management/LIME/RFC_CORECore Package of the RFC Interface
/LIME/COLL_W2IMCollection for WME after ERP-MMIM/LIME/RFC_CORECore Package of the RFC Interface
/BA1/TF4_MATSTRCCurrencies of Maturity Structure/BA1/F4_YCMarket Data: Yield Curves
/BA1/TF4_MATSTRPProperties of Maturity Structure/BA1/F4_YCMarket Data: Yield Curves
/BA1/TF4_MDSETVUnderlying Independent Volatilities per Currency/BA1/F4_BASISBasic Market Data
/BA1/TF4_REFRATEReference Interest Rates: Attributes/BA1/F4_YCMarket Data: Yield Curves
/BA1/TF4_RRATESReference Interest Rates/BA1/F4_IRMarket Data: Interest Rates
/BA1/TF4_SCS_YCZero Shifts for Yield Curves/BA1/F4_SCENMarket Data: Scenarios
/BA1/TF4_STDYCStandard Yield Curves/BA1/F4_YCMarket Data: Yield Curves
/BA1/TF4_SYCGRIDStandard Yield Curves: Grid Points for Reference Int. Rates/BA1/F4_YCMarket Data: Yield Curves
/BA1/TF4_UNITDefinition of Exchange Rate Units/BA1/F4_BASISBasic Market Data
BUT053BP Relationship: Company InterestBUPA_COMMONGeneral SAP Business Partner
BUT054BP Relationship (not used yet)BUPASAP Business Partner
COMC_VALAREA_R3Valuation Areas in R/3ABA_PRODUCT_OBSOLETEObsolete Product Parts Still Used
T056RInterest reference definitionFREFINTERESTReference Interest Rate
KCD_CURDESExternal data transfer: target currencyBKDTools for (external) data transfer
MASSDTESTObject for Testing MASS/MASSDMASSDMass Maintenance Dialog
P2EM_SV_AEPayroll Result: SI Data for UAEPCAEEnhancements Payroll and Time Mgmt UAE
PA3251HR Master Record: Infotype 3251PBAEEnhancements Master Data UAE
T7AE02UAE Statutory Social Insurance Contribution TablePBAEEnhancements Master Data UAE
T7AE02CUAE Statutory Social Insurance Contribution TablePBAEEnhancements Master Data UAE
T7AE04UAE Private Social Insurance Contribution TablePBAEEnhancements Master Data UAE
T7AE11Home Airport (UAE)PBAEEnhancements Master Data UAE
PA3358HR Master Record: Infotype 3358PAEP1Master Data AE PBS
PA0390Income Tax: DeductionsPB29HR Master Data: Argentina
PA0391Income Tax: Information on other employersPB29HR Master Data: Argentina
PA0392Social Security: General dataPB29HR Master Data: Argentina
PA0551Termination of contract: General dataPB29HR Master Data: Argentina
T7AR05Additional information by CompanyPB29HR Master Data: Argentina
T7AR44Scale for Welfare Fund distribution percentagesPB29HR Master Data: Argentina
T7AR53Limits and values by income tax categoryPB29HR Master Data: Argentina
T7AR54Income scale for income tax calculationPB29HR Master Data: Argentina
T7AR56Income Tax - Deductions reductionPB29HR Master Data: Argentina
T7AR61Rules for generating family allowance wage typesPB29HR Master Data: Argentina
T7AR61CRules for generating family allowance wage typesPB29HR Master Data: Argentina
T7AR94Basic wage limit agreement for seniority compensationPB29HR Master Data: Argentina
P2AR_ARASFAMFamily Allowance result informationPC29Argentina
P2AR_ARCIMPTax resultsPC29Argentina
P2AR_ARDIMPTax deduction resultsPC29Argentina
P2AR_ARPRVAStructure item for calculation of vacation provisionPC29Argentina
P2AR_ARPRVRHeader structure for vacation provisionPC29Argentina
P2AR_ARTERTermination of contract: General dataPC29Argentina
T77PAYAR_RUBRLimits and values by income tax categoryPC29Argentina
T77PAYAR_SALRGSalary brackets available for Income TaxPC29Argentina
PA0526HR Master Record: Infotype 0526PB03Human Resources Master Data: Austria
PA3233HR Master Record: Infotype 3233PB03Human Resources Master Data: Austria
HRPAYAT_PAYRSRESSaves Wage Types from Simulated Payroll ResultsPC03HR Payroll: Austria
HRPAYAT_PAYRSRESSaves Wage Types from Simulated Payroll ResultsPC03HR Payroll: Austria
P2RA_DFRTPayroll Result for Other Payroll PeriodsPC03HR Payroll: Austria
P2RA_DFRTPayroll Result for Other Payroll PeriodsPC03HR Payroll: Austria
P2RA_SPPayroll Results: Special PaymentsPC03HR Payroll: Austria
T5A2_J6Data Backup on Termination Due to EStG Sec.77 4aPC03HR Payroll: Austria
T5A71L16 Consolidation FilePC03HR Payroll: Austria
T5A72BGN(GKK) Consolidation FilePC03HR Payroll: Austria
T5A73BGN(BVA) Consolidation FilePC03HR Payroll: Austria
T5A74E18 Consolidation FilePC03HR Payroll: Austria
PA0484HR Master Record Infotype 0484 (Joint Taxation A)P03P1HR Public Sector Austria
PA0701HR Terminations Data Container : Infotype 0701PB13HR master data: Australia
PA0817Income Tax Withholding Variation(Australia)PB13HR master data: Australia
PA0817Income Tax Withholding Variation(Australia)PB13HR master data: Australia
PA0849Infotype for Payment SummaryPB13HR master data: Australia
PA0850Infotype for Eligible Termination PaymentPB13HR master data: Australia
PA3348HR Master Record: Infotype 3348PB13HR master data: Australia
P2RQ_ACRTACRT for Single Touch Payroll (Australia)PC13HR accounting: Australia
P2RQ_AETPAETP Cluster for ETP details (Australia)PC13HR accounting: Australia
P2RQ_HTPayroll Results: Results TablePC13HR accounting: Australia
P2RQ_HTPayroll Results: Results TablePC13HR accounting: Australia
P2RQ_NTPayroll Results: Results TablePC13HR accounting: Australia
P2RQ_NTPayroll Results: Results TablePC13HR accounting: Australia
P2RQ_PASUMPayment summary componentsPC13HR accounting: Australia
P2RQ_QDDCONAustralia Public Sector: PayrollPC13HR accounting: Australia
P2RQ_QHDAHR-AU-PS: Payroll structure for Higher Duty AllowancePC13HR accounting: Australia
P2RQ_QSPRHR-AU-PS: Payroll structure for SuperannuationPC13HR accounting: Australia
P2RQ_RETPPayroll Structure: RETP TablePC13HR accounting: Australia
P2RQ_SMTHSMTH and SQTR for Superannuation (Australia)PC13HR accounting: Australia
P2RQ_SMTHSMTH and SQTR for Superannuation (Australia)PC13HR accounting: Australia
P2RQ_SQTRSMTH and SQTR for Superannuation (Australia)PC13HR accounting: Australia
P2RQ_SQTRSMTH and SQTR for Superannuation (Australia)PC13HR accounting: Australia
P2RQ_TVARPStructure for Income Tax Withholding variations (Australia)PC13HR accounting: Australia
P2RQ_TVARPStructure for Income Tax Withholding variations (Australia)PC13HR accounting: Australia
T5QGOGroup Certificate OverridesPC13HR accounting: Australia
T5QSOAdjust YTD Amounts for STP ReportingPC13HR accounting: Australia
PA0507HR-AU-PS: Master Data (Superannuation)P13P1HR-AU-PS: Master data for Public sector Australia
PA0567HR AU PS:Master Data Data ContainerP13P8HR-AU-PS : Terminations and Redundany module
PA0101HR Master Record: Infotype 0101 (Tax B)PB12HR Master Data: Belgium
PA0109HR Master Record: Infotype 0109 (Contract Elements B)PB12HR Master Data: Belgium
PA0125HR Master Record: Infotype 0125 (Garnishment B)PB12HR Master Data: Belgium
PA0504Pensioner's Advantage BPB12HR Master Data: Belgium
PA0505HR Master Record: Infotype 0505PB12HR Master Data: Belgium
PA0569HR Master Record: Infotype 0569PB12HR Master Data: Belgium
PB0109HR Master Record: Infotype 0109 (Contract Elements B)PB12HR Master Data: Belgium
P2RB_BEEVLPayroll Results: Belgium table for EvaluationPC12HR accounting: Belgium
P2RB_BHOLPHoliday PayPC12HR accounting: Belgium
P2RB_CIPayroll Result: Complementary Indemnity- CI (BE)PC12HR accounting: Belgium
P2RB_CIPPayroll Result: Complementary Indemnity Payments (BE)PC12HR accounting: Belgium
P2RB_DAYDETDaydetails for payroll outsourcing (B)PC12HR accounting: Belgium
P2RB_DAYDETDaydetails for payroll outsourcing (B)PC12HR accounting: Belgium
P2RB_FIREFire payroll BelgiumPC12HR accounting: Belgium
P2RB_I0125Garnishment payroll BelgiumPC12HR accounting: Belgium
P2RB_PENSPensioner's data (B)PC12HR accounting: Belgium
P2RB_PKPension Fund, Payroll BelgiumPC12HR accounting: Belgium
P2RB_SPPayroll Results: Special PaymentsPC12HR accounting: Belgium
P2RB_STTax payroll BelgiumPC12HR accounting: Belgium
P2RB_SVSocial Insurance payroll BelgiumPC12HR accounting: Belgium
P2RB_SVCICComplementary Indemnity ContributionsPC12HR accounting: Belgium
P2RB_SVREMPayroll Results: DMFA Remuneration codesPC12HR accounting: Belgium
T5BC0Rail Tariff for Commuting Expenses (B)PC12HR accounting: Belgium
T5BFBCO2 coefficient per pollution categoryPC12HR accounting: Belgium
T5BFDCO2 percentages and limits per pollution categoryPC12HR accounting: Belgium
T5BFTFiscal Horsepower Rate per KilometerPC12HR accounting: Belgium
T5BL0HR-BE : Transparent table for Holiday PayPC12HR accounting: Belgium
T5BVJLevels and legal amounts for SI reductionsPC12HR accounting: Belgium
PA0937HR Master Record: Infotype 0937PBBGHR payroll: Bulgaria
PA0938HR Master Record: Infotype 0938PBBGHR payroll: Bulgaria
PA0940HR Master Record: Infotype 0940PBBGHR payroll: Bulgaria
PB0937Applicant data infotype 0937 (model)PBBGHR payroll: Bulgaria
PB0938Applicant data infotype 0938 (model)PBBGHR payroll: Bulgaria
PB0940Applicant data infotype 0940 (model)PBBGHR payroll: Bulgaria
T7BGA1Bank transfer - interface tablePCBGHR payroll: Bulgaria
T7BGA2Changes of external transfers (IT11)PCBGHR payroll: Bulgaria
PA0661Termination: general dataPB37HR master data: Brazil
PA0737Alimony debit for BrazilPB37HR master data: Brazil
PA0738Alimony adjustment for BrazilPB37HR master data: Brazil
T7BR1BUnionPB37HR master data: Brazil
T7BRB2Branch - Social insurance bodyPB37HR master data: Brazil
T7BRCO5Compensation balance of GSWPB37HR master data: Brazil
T7BRCO6Field values of GSW (FCSWI)PB37HR master data: Brazil
T7BREFD_BENEFPayment beneficiary identification.PB37HR master data: Brazil
T7BREFD_DEPPLANDependent of health care private planPB37HR master data: Brazil
T7BREFD_EEGARPayments made to alimony beneficiariesPB37HR master data: Brazil
T7BREFD_EEREMRemuneration informationPB37HR master data: Brazil
T7BREFD_EETERMTerminationPB37HR master data: Brazil
T7BREFD_FEDLIMFederative person compensation limitsPB37HR master data: Brazil
T7BREFD_ININFOTrainee exclusive informationPB37HR master data: Brazil
T7BREFD_NDOCKRemuneration of temporary workers, non dockworkersPB37HR master data: Brazil
T7BREFD_NFSInvoice detailsPB37HR master data: Brazil
T7BREFD_NIDENPAYPayments to unidentified beneficiariesPB37HR master data: Brazil
T7BREFD_PAYRESCDetails on payments made regarding terminationsPB37HR master data: Brazil
T7BREFD_PREVINFPayment detailPB37HR master data: Brazil
T7BREFD_PSPYWTAMWage types that form the employee remunerationPB37HR master data: Brazil
T7BREFD_PYBENINFDetail of payments regarding Welfare benefitsPB37HR master data: Brazil
T7BREFD_PYPARTComp.information regarding the partial made paymentPB37HR master data: Brazil
T7BREFD_PYPAYINFDetails on payments made regarding payrollPB37HR master data: Brazil
T7BREFD_PYREOTRemuneration other company codesPB37HR master data: Brazil
T7BREFD_PYWTAMWage types that form the employee remunerationPB37HR master data: Brazil
T7BREFD_RULAWLawsuit of rural producerPB37HR master data: Brazil
T7BREFD_RURALACQAcquisition of rural production informationPB37HR master data: Brazil
T7BREFD_RURLWRKRRural producer informationPB37HR master data: Brazil
T7BREFD_UNIONDUEInformation on the employer union duesPB37HR master data: Brazil
T7BREFD_VACPAYDetail of payments made regading the vacation.PB37HR master data: Brazil
T7BRGRSIB table - Self-employedPB37HR master data: Brazil
T7BRSFChild allowancePB37HR master data: Brazil
T7BRSISIB tablePB37HR master data: Brazil
T7BRTAUnion duesPB37HR master data: Brazil
T7BRTRTransportation ticketPB37HR master data: Brazil
T7BRTXWIT tablePB37HR master data: Brazil
T7BRUNIONDUEInformation on the employer union duesPB37HR master data: Brazil
P2BR_9LRERSLRetroactive accounting resultsPC37HR settlement: Brazil
P2BR_ACJRSLResults from job accumulationPC37HR settlement: Brazil
P2BR_BRAVERAGEFrozen averagesPC37HR settlement: Brazil
P2BR_BRDBTResult of Labor Debits UpdatePC37HR settlement: Brazil
P2BR_BRPROVBRPROV (reserve)PC37HR settlement: Brazil
P2BR_BRPRVVBRPRVV (Leave Reserve)PC37HR settlement: Brazil
P2BR_BRSOCSS calculation - Social InsurancePC37HR settlement: Brazil
P2BR_BRTAXWithholding Income TaxPC37HR settlement: Brazil
P2BR_OVUNPCredits and debitsPC37HR settlement: Brazil
P2RK_GRCUMCumulation for garnishment resultsPC07HR accounting: Canada
P2RK_TCRTPayroll Results - Fed. and Prov. Tax CumulationsPC07HR accounting: Canada
PA0120HR Master Record: Infotype 0120 (Pension Fund Trans. CH)PB02HR Master Data: Switzerland
PA0980HR Master Record Infotype 0980PB02HR Master Data: Switzerland
P2RC_CHVSHR-CH: Payroll result insurancePC02HR Payroll: Switzerland
P2RC_PKHR-CH: Pension fund payroll valuesPC02HR Payroll: Switzerland
T5CS7HR-CH: Premium Rates for InsurancePC02HR Payroll: Switzerland
PA3235HR Master Record: Infotype 3235PB39HR Master Data - Chile
PA3235HR Master Record: Infotype 3235PB39HR Master Data - Chile
PA3235HR Master Record: Infotype 3235PB39HR Master Data - Chile
PA3235HR Master Record: Infotype 3235PB39HR Master Data - Chile
PA3235HR Master Record: Infotype 3235PB39HR Master Data - Chile
PA3235HR Master Record: Infotype 3235PB39HR Master Data - Chile
PA3235HR Master Record: Infotype 3235PB39HR Master Data - Chile
PA3235HR Master Record: Infotype 3235PB39HR Master Data - Chile
PA3235HR Master Record: Infotype 3235PB39HR Master Data - Chile
PA3235HR Master Record: Infotype 3235PB39HR Master Data - Chile
PA3236Reserved for Molga 39 (Payroll Chile)PB39HR Master Data - Chile
T7CL03Family Allowance BracketsPB39HR Master Data - Chile
T7CL17Tax BracketsPB39HR Master Data - Chile
PA3212HR Master Record: Infotype 3212 (Special Payment CN)PB28HR master data: China
PA3422HR Master Record: Infotype 3422PB28HR master data: China
PA3533HR Master Record: Infotype 3533PB28HR master data: China
T7CN13Salary information (CN)PB28HR master data: China
T7CN13_TAXSalary Information for Tax Area (CN)PB28HR master data: China
T7CN17Minimum SalaryPB28HR master data: China
T7CN20_CHICHI Tax Exemption for Tax Area (CN)PB28HR master data: China
T7CN20_CHICHI Tax Exemption for Tax Area (CN)PB28HR master data: China
T7CN20_CPICPI Tax Exemption for Tax Area (CN)PB28HR master data: China
T7CN33Exempted Amount TablePB28HR master data: China
T7CN36Tax grouping for companyPB28HR master data: China
T7CNC0Contribution CalculationPB28HR master data: China
T7CNDE_AMOUNTDeduction Amount for Deduction TypePB28HR master data: China
T7CNDE_AMOUNTDeduction Amount for Deduction TypePB28HR master data: China
T7CNSTCN: Last Result of Simulate Termination Payment for Labor WBPB28HR master data: China
T7CNTX_AMTTax Area Relevant AmountPB28HR master data: China
P2CN_CNREIPayroll result: structure for retro difference detailsPC28HR accounting: China
P2CN_CNREIPayroll result: structure for retro difference detailsPC28HR accounting: China
P2CN_CNREOPayroll result: structure for retro difference detailsPC28HR accounting: China
P2CN_CNREOPayroll result: structure for retro difference detailsPC28HR accounting: China
P2CN_CNSPPayroll result: Special Payment (CN)PC28HR accounting: China
P2CN_SUIPayroll result: Supplementary Insurance (CN)PC28HR accounting: China
P2CN_TAXPayroll result: Income Tax (CN)PC28HR accounting: China
PA0829HR master record for infotypes 0829PB38Human Resources master data: Colombia
PA0830HR master record for infotypes 0830PB38Human Resources master data: Colombia
PA0831HR master record for infotypes 0831PB38Human Resources master data: Colombia
PA0831HR master record for infotypes 0831PB38Human Resources master data: Colombia
PA0831HR master record for infotypes 0831PB38Human Resources master data: Colombia
PA0832HR master record for infotypes 0832PB38Human Resources master data: Colombia
PA0834HR master record for infotypes 0834PB38Human Resources master data: Colombia
PA0835HR master record for infotypes 0835PB38Human Resources master data: Colombia
PA0836HR master record for infotypes 0836PB38Human Resources master data: Colombia
PA0847HR master record for infotypes 0847PB38Human Resources master data: Colombia
PA0880HR master record for infotypes 0880PB38Human Resources master data: Colombia
PB0836Candidates data for infotype 0836 (sample)PB38Human Resources master data: Colombia
T7CO08Solidarity fund and retentionPB38Human Resources master data: Colombia
T7CO13Credit and debit memos and interestsPB38Human Resources master data: Colombia
T7CO31DIAN items groupingPB38Human Resources master data: Colombia
T7COT1Payroll external results transfer: COSSOPB38Human Resources master data: Colombia
T7COT2Payroll external results transfer: COSSAPB38Human Resources master data: Colombia
T7COT3Payroll external results transfer: COSEVPB38Human Resources master data: Colombia
T7COT5Payroll external results transfer: COBTRPB38Human Resources master data: Colombia
T7COT6Payroll external results transfer: COGARPB38Human Resources master data: Colombia
T7COT7Payroll external results transfer: COTAXPB38Human Resources master data: Colombia
T7COT8Payroll external results transfer: COAVAPB38Human Resources master data: Colombia
T7COT8Payroll external results transfer: COAVAPB38Human Resources master data: Colombia
T7COT9Payroll external results transfer: COPROPB38Human Resources master data: Colombia
T7COT9Payroll external results transfer: COPROPB38Human Resources master data: Colombia
T7COT9Payroll external results transfer: COPROPB38Human Resources master data: Colombia
T7COT9Payroll external results transfer: COPROPB38Human Resources master data: Colombia
T7COT9Payroll external results transfer: COPROPB38Human Resources master data: Colombia
T7COT9Payroll external results transfer: COPROPB38Human Resources master data: Colombia
T7COT9Payroll external results transfer: COPROPB38Human Resources master data: Colombia
T7COT9Payroll external results transfer: COPROPB38Human Resources master data: Colombia
T7COTAPayroll external results transfer: COICCPB38Human Resources master data: Colombia
P2CO_9LRERSLRetroactive Accounting ResultsPC38Payroll: Colombia
P2CO_COAVAPC2CO_AVAPC38Payroll: Colombia
P2CO_COAVAPC2CO_AVAPC38Payroll: Colombia
P2CO_COBTRPC2CO_BTRPC38Payroll: Colombia
P2CO_COGARPC2CO_GARPC38Payroll: Colombia
P2CO_COICCPC2CO_ICCPC38Payroll: Colombia
P2CO_COPROPC2CO_PROPC38Payroll: Colombia
P2CO_COPROPC2CO_PROPC38Payroll: Colombia
P2CO_COPROPC2CO_PROPC38Payroll: Colombia
P2CO_COPROPC2CO_PROPC38Payroll: Colombia
P2CO_COPROPC2CO_PROPC38Payroll: Colombia
P2CO_COPROPC2CO_PROPC38Payroll: Colombia
P2CO_COPROPC2CO_PROPC38Payroll: Colombia
P2CO_COPROPC2CO_PROPC38Payroll: Colombia
P2CO_COSEVPC2CO_SEVPC38Payroll: Colombia
P2CO_COSSAPC2CO_SSAPC38Payroll: Colombia
P2CO_COSSOPC2CO_SSOPC38Payroll: Colombia
P2CO_COSSPPC2CO_SSPPC38Payroll: Colombia
P2CO_COTAXPC2CO_TAXPC38Payroll: Colombia
PA0244Infotype 0244 - Income from previous ERPB18HR master data: Czech Republic
PA0245Infotype 0245 - Annual tax calculation CZPB18HR master data: Czech Republic
P2RT_CZDAVP18_03PC18HR payroll: Czech Republic
T5T4045RZD results for calculation receipt - MD /404 and /405PC18HR payroll: Czech Republic
T5TA1Source data for external transfersPC18HR payroll: Czech Republic
T5TA3Results of annual tax calculation to be includedPC18HR payroll: Czech Republic
T5TA4Social insurance differences for FI postingPC18HR payroll: Czech Republic
T5TPS0730Additional data of infotype 0730P18PSHRCZ Public Sector
T5TPSC1SPLITCost distributionP18PSHRCZ Public Sector
P01CBEActive CPS ContributionsP01AHR Germany: Retirement Pension Plan
P01CBFNotional CPS ContributionsP01AHR Germany: Retirement Pension Plan
P01CBTTransfer Records for Reimbursement of Contributions CPSP01AHR Germany: Retirement Pension Plan
P01CCVCPS Cumulated Future RightsP01AHR Germany: Retirement Pension Plan
P01CEEActual Income CPSP01AHR Germany: Retirement Pension Plan
P01CEFNotional Income CPSP01AHR Germany: Retirement Pension Plan
P01CGPVested Entitlements CPSP01AHR Germany: Retirement Pension Plan
P01CKAFunded Pension Rights CPSP01AHR Germany: Retirement Pension Plan
P01CRPReimbursement Amounts CPSP01AHR Germany: Retirement Pension Plan
P01CSLSocial Benefits CPSP01AHR Germany: Retirement Pension Plan
P01CSOSpecial InformationP01AHR Germany: Retirement Pension Plan
P01CSTStatus Information CPSP01AHR Germany: Retirement Pension Plan
P01CUAVested Pension Rights CPSP01AHR Germany: Retirement Pension Plan
P01CVDActuarial CPS DataP01AHR Germany: Retirement Pension Plan
P01CVDActuarial CPS DataP01AHR Germany: Retirement Pension Plan
P01CVDActuarial CPS DataP01AHR Germany: Retirement Pension Plan
P01CVRActuarial CPS Pension DataP01AHR Germany: Retirement Pension Plan
P01CVUCapital Transfers for CPSP01AHR Germany: Retirement Pension Plan
P01RBM_MZ01Reporting Data MZ01 Pension Receipt NotificationP01AHR Germany: Retirement Pension Plan
P01RBM_MZ01RConfirmation MZ01 Pension Receipt NotificationP01AHR Germany: Retirement Pension Plan
P01RBM_MZ01RBTGDConfirmation MZ01 Pension Receipt Notif.: Contribution DataP01AHR Germany: Retirement Pension Plan
P01RBM_MZ01_BTGDReporting Data MZ01 Pension Receipt Notif.: Contribut. DataP01AHR Germany: Retirement Pension Plan
P01VA_BEActual Contributions CPS for Pension Equalization PaymentP01AHR Germany: Retirement Pension Plan
P01VA_BFNotional Contributions CPS for Pension Equalization PaymentP01AHR Germany: Retirement Pension Plan
P01VA_CBEReduction Amounts for Actual Contributions CPSP01AHR Germany: Retirement Pension Plan
P01VA_CBFReduction Amounts for Notional Contributions CPSP01AHR Germany: Retirement Pension Plan
P01VA_CKAReduction Amounts for Funded Pension Rights CPSP01AHR Germany: Retirement Pension Plan
P01VA_KAFunded Pension Rights CPS for Pension Equalization PaymentP01AHR Germany: Retirement Pension Plan
PA0201HR Master Record Infotype 0201 (Basic Pension Payments)P01AHR Germany: Retirement Pension Plan
PA0229HR Master Record Infotype 0229P01AHR Germany: Retirement Pension Plan
PA0263HR Master Record for Infotype 0263P01AHR Germany: Retirement Pension Plan
PA0746HR Master Record for Infotype 0746P01AHR Germany: Retirement Pension Plan
T5DVPDefinition of Identifiers for Default ValuesP01AHR Germany: Retirement Pension Plan
T5DWFCPS Currency KeyP01AHR Germany: Retirement Pension Plan
P01Y15PAISY: Management Table Subrecord Type 15P01YHuman Resources Germany: PAISY Interface
P2RD_ANVERSPayroll Result - Cluster RD: Structure for Imp. on PensionPC01HR Payroll: Germany
P2RD_ANVERSPayroll Result - Cluster RD: Structure for Imp. on PensionPC01HR Payroll: Germany
P2RD_DGITPayroll Result D: Output Table for ITPC01HR Payroll: Germany
P2RD_DGITPayroll Result D: Output Table for ITPC01HR Payroll: Germany
P2RD_SPPayroll Results: Special PaymentsPC01HR Payroll: Germany
P2RD_VERSORGUNGPayroll Result: Pension Payment (PS)PC01HR Payroll: Germany
P2RD_VERSORGUNGPayroll Result: Pension Payment (PS)PC01HR Payroll: Germany
T5D4ZHealth Insurance Fund List per Contribution StatementPC01HR Payroll: Germany
PA0215Construction Pay Transaction DataP01BPayroll: Construction Industry
T5D6HGarnishment Pension Scheme Age Pay ScalesP01PHR Germany: Garnishments
T5D6IGarnishment Pension Scheme Age Pay ScalesP01PHR Germany: Garnishments
P01BN_DATAContrib. Statement: Estimate and Corr. Values of Prev. MonthP01SHR Germany: Social Insurance
P01EA_VRBNAdministration of Reimbursement Amounts to Be ClearedP01SHR Germany: Social Insurance
PA0942HR Master Record Infotype 0942P01SHR Germany: Social Insurance
P01ZFA_NN_DATAZfA: Notifications Not AssignedP01OHR Germany: Public Sector
P593RApplication Status: SI Reimbursement for RehabilitantsP01OHR Germany: Public Sector
PA0322HR Master Record: Infotype 0322 (Pensions and Rel. Ben.)P01OHR Germany: Public Sector
PA0322HR Master Record: Infotype 0322 (Pensions and Rel. Ben.)P01OHR Germany: Public Sector
PA0326HR Master Rec.: Infotype 0326 (Imputation to Pension Payts)P01OHR Germany: Public Sector
PA0326HR Master Rec.: Infotype 0326 (Imputation to Pension Payts)P01OHR Germany: Public Sector
PA0326HR Master Rec.: Infotype 0326 (Imputation to Pension Payts)P01OHR Germany: Public Sector
PA0326HR Master Rec.: Infotype 0326 (Imputation to Pension Payts)P01OHR Germany: Public Sector
PA0326HR Master Rec.: Infotype 0326 (Imputation to Pension Payts)P01OHR Germany: Public Sector
PA0326HR Master Rec.: Infotype 0326 (Imputation to Pension Payts)P01OHR Germany: Public Sector
PA0329HR Master Record: Infotype 0329 (Sideline Job)P01OHR Germany: Public Sector
PA0330Infotype 0330 (Non-Monetary Remuneration)P01OHR Germany: Public Sector
PA0592HR Master Record: Infotype 0592 (Foreign Public Sector)P01OHR Germany: Public Sector
PDPBSZVSUMTotals Record (Record Type 90), SPIP01O_ZVSP Notification Program for Public Sector Germany
T510QCost-of-Living AllowancesP01OHR Germany: Public Sector
T5D8EAccommodation, Infotype 30 (payments in kind)P01OHR Germany: Public Sector
T5D8FNon-Monetary Remuneration: Meals, Infotype 0330P01OHR Germany: Public Sector
T5D96Basic Amounts: Bonus for Foreign Service BonusP01OHR Germany: Public Sector
PA0780HR Master Record Infotype 0780 (Sec. 53 Employer Data)P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0780HR Master Record Infotype 0780 (Sec. 53 Employer Data)P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0780HR Master Record Infotype 0780 (Sec. 53 Employer Data)P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0780HR Master Record Infotype 0780 (Sec. 53 Employer Data)P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0781HR Master Record Infotype 0781 (Sec. 53 Income Data)P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0782HR Master Record Infotype 0782P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0782HR Master Record Infotype 0782P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0782HR Master Record Infotype 0782P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0782HR Master Record Infotype 0782P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0782HR Master Record Infotype 0782P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0782HR Master Record Infotype 0782P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0782HR Master Record Infotype 0782P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0782HR Master Record Infotype 0782P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0782HR Master Record Infotype 0782P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0782HR Master Record Infotype 0782P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0782HR Master Record Infotype 0782P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0782HR Master Record Infotype 0782P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0782HR Master Record Infotype 0782P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0784HR Master Record Infotype 0784P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0785HR Master Record Infotype 0785P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0785HR Master Record Infotype 0785P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0786HR Master Record Infotype 0786P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0786HR Master Record Infotype 0786P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0786HR Master Record Infotype 0786P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0786HR Master Record Infotype 0786P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0786HR Master Record Infotype 0786P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0786HR Master Record Infotype 0786P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0786HR Master Record Infotype 0786P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0786HR Master Record Infotype 0786P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0788HR Master Record Infotype 0788P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0789HR Master Record Infotype 0789P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0790HR Master Record Infotype 0790P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0790HR Master Record Infotype 0790P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0790HR Master Record Infotype 0790P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0790HR Master Record Infotype 0790P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0845HR Master Record Infotype 0845 (Work Relationships)P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0846Infotype 0846: ReimbursementsP01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0846Infotype 0846: ReimbursementsP01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0846Infotype 0846: ReimbursementsP01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0883HR Master Record for Infotype 0883P01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PA0884HR Master Record for Infotype 0884P01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PA0884HR Master Record for Infotype 0884P01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PA0884HR Master Record for Infotype 0884P01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PA0884HR Master Record for Infotype 0884P01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PA0884HR Master Record for Infotype 0884P01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PA0884HR Master Record for Infotype 0884P01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PA0884HR Master Record for Infotype 0884P01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PA0884HR Master Record for Infotype 0884P01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PA0884HR Master Record for Infotype 0884P01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PA0884HR Master Record for Infotype 0884P01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PAPBSDENV_ANZREntitlement PeriodsP01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PAPBSDENV_ANZR_DDynamized Entitlement Periods - ResultP01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PAPBSDENV_ANZR_DDynamized Entitlement Periods - ResultP01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PAPBSDENV_POINInput for Posting RunP01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PAPBSDENV_RESULTResults/Payment Table Retroactive Pension InsuranceP01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PAPBSDENV_RESULTResults/Payment Table Retroactive Pension InsuranceP01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PAPBSDENV_RESULTResults/Payment Table Retroactive Pension InsuranceP01PBSNVRetroactive Pension Insurance PI Public Sector Germany
PAPBSDEVA_VLTSV1Results Treaty on Sharing of Pension CostsP01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PAPBSDEVA_VLTSV1Results Treaty on Sharing of Pension CostsP01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
T7DEPBSVAVG01Current Pension Value (East, West)P01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
T7DEPBSVAVG04Average RemunerationP01PBSVAVG_DDICHR-VADM: Public Sector Pensions Act (DDIC, User Interface)
PA0072HR Master Record: Infotype 0072 (Fiscal Data - DK)PB09HR Master Data: Denmark
PA0072HR Master Record: Infotype 0072 (Fiscal Data - DK)PB09HR Master Data: Denmark
PA0072HR Master Record: Infotype 0072 (Fiscal Data - DK)PB09HR Master Data: Denmark
PA0072HR Master Record: Infotype 0072 (Fiscal Data - DK)PB09HR Master Data: Denmark
PA0072HR Master Record: Infotype 0072 (Fiscal Data - DK)PB09HR Master Data: Denmark
PA0073HR Master Record: Infotype 0073 (Private Pensions - DK)PB09HR Master Data: Denmark
PA0073HR Master Record: Infotype 0073 (Private Pensions - DK)PB09HR Master Data: Denmark
PA0074HR Master Record: Infotype 0074 (Leave Processing - DK)PB09HR Master Data: Denmark
PA0214HR Master Record Infotype 0214PB09HR Master Data: Denmark
T5M6PDefault Values for Leave AccumulationPB09HR Master Data: Denmark
PA0200HR Master Record, Infotype 0200 (Garnishments DK)PC09HR Payroll: Denmark
PA0200HR Master Record, Infotype 0200 (Garnishments DK)PC09HR Payroll: Denmark
PA0200HR Master Record, Infotype 0200 (Garnishments DK)PC09HR Payroll: Denmark
T5M7NSpecial Wage Type Definition Elements for Pensions (DK)PC09HR Payroll: Denmark
T5M7NSpecial Wage Type Definition Elements for Pensions (DK)PC09HR Payroll: Denmark
PA3389HR Master Record: Infotype 3389PBEGHR Master data: Egypt
PA3392HR Master Record: Infotype 3392PBEGHR Master data: Egypt
PA3404HR Master Record: Infotype 3404PBEGHR Master data: Egypt
PB3392Applicant data infotype 3392 (model)PBEGHR Master data: Egypt
T7EG02Social Insurance Fund AttributesPBEGHR Master data: Egypt
P2EG_TCRTTax CRTPCEGHR Payroll: Egypt
P2EG_TELEMENTEgypt Tax ElementsPCEGHR Payroll: Egypt
T7EG18End of service Calculation Rule AttributesPCEGHR Payroll: Egypt
T7EGT02Tax GroupsPCEGHR Payroll: Egypt
T7EGT03Tax SlabsPCEGHR Payroll: Egypt
PA0887HR master record, infotype 0887PB04HR Master Data: Spain
PA0968HR master record infotype 0968PB04HR Master Data: Spain
T5E07Health services amounts for company contributing to S.I.PB04HR Master Data: Spain
T5E40Employment tax deduction percentagesPB04HR Master Data: Spain
T5E43Contribution bases for non-industrial risksPB04HR Master Data: Spain
T5E44Contribution bases for IA and ID quotasPB04HR Master Data: Spain
T5E50Minimum bases for part-time contractsPB04HR Master Data: Spain
T5EI1Employment tax deduction ratesPB04HR Master Data: Spain
T5EI2Wage exempt of employment tax deductionPB04HR Master Data: Spain
T5EI4Employment tax amount constantsPB04HR Master Data: Spain
T5EI8Lowering of deduction type for challenged personsPB04HR Master Data: Spain
T5ES6Allowance formulasPB04HR Master Data: Spain
P2RE_GARNTPayroll result: Garnishments (Spain)PC04HR Payroll: Spain
P2RE_SPPayroll Results: Special PaymentsPC04HR Payroll: Spain
T5E4AContribution limits per non-industrial risksPC04HR Payroll: Spain
T5E4IContribution limits according to full remunerationsPC04HR Payroll: Spain
T7FIC0Age groups for company cars (Finland)PB44HR master data: Finland
P2FI_CSTTax result table for Finland, cumulativePC44HR accounting: Finland
P2FI_GARGarnishment results FinlandPC44HR accounting: Finland
P2FI_SCRTTax result table for Finland, cumulated wage type levelPC44HR accounting: Finland
P2FI_SIRTSI result table for Finland, cumulated wage type levelPC44HR accounting: Finland
P2FI_STTax result structure for FinlandPC44HR accounting: Finland
T7FILISTable for Low Income Support StatementPC44HR accounting: Finland
T7FIOIXIdx Vacation Accr + ER SCR contrib.->Posting item, A-setsPC44HR accounting: Finland
T7FIT0Trade Unions FinlandPC44HR accounting: Finland
T7FITUTrade Unions / Locals FinlandPC44HR accounting: Finland
PA0098Infotype 0098 (Profit Sharing - France)PB06HR master data: France
PA0098Infotype 0098 (Profit Sharing - France)PB06HR master data: France
PA0098Infotype 0098 (Profit Sharing - France)PB06HR master data: France
PA0098Infotype 0098 (Profit Sharing - France)PB06HR master data: France
PA0098Infotype 0098 (Profit Sharing - France)PB06HR master data: France
PA0098Infotype 0098 (Profit Sharing - France)PB06HR master data: France
PA0098Infotype 0098 (Profit Sharing - France)PB06HR master data: France
PA0098Infotype 0098 (Profit Sharing - France)PB06HR master data: France
PA0098Infotype 0098 (Profit Sharing - France)PB06HR master data: France
PA0098Infotype 0098 (Profit Sharing - France)PB06HR master data: France
PA0098Infotype 0098 (Profit Sharing - France)PB06HR master data: France
PA0098Infotype 0098 (Profit Sharing - France)PB06HR master data: France
PA0098Infotype 0098 (Profit Sharing - France)PB06HR master data: France
PA0272Infotype 0272 (Garnishment)PB06HR master data: France
PA0272Infotype 0272 (Garnishment)PB06HR master data: France
PA0272Infotype 0272 (Garnishment)PB06HR master data: France
PA0424Industrial accident / maternity / sickness statement (FR)PB06HR master data: France
PA0425Data Entry of Per Diem Sick Pay SummaryPB06HR master data: France
PA0873Infotype 0873PB06HR master data: France
T5F3BCalculation Bases for Profit SharingPB06HR master data: France
T5F5QCompany/Workplace DataPB06HR master data: France
HRP1690DB Table for Infotype 1690P99S_TNMTraining needs management
HRP1691DB Table for Infotype 1691P99S_TNMTraining needs management
HRP1691DB Table for Infotype 1691P99S_TNMTraining needs management
HRP1691DB Table for Infotype 1691P99S_TNMTraining needs management
HRP1691DB Table for Infotype 1691P99S_TNMTraining needs management
HRP1691DB Table for Infotype 1691P99S_TNMTraining needs management
HRP1691DB Table for Infotype 1691P99S_TNMTraining needs management
HRP1691DB Table for Infotype 1691P99S_TNMTraining needs management
HRP1691DB Table for Infotype 1691P99S_TNMTraining needs management
HRP1691DB Table for Infotype 1691P99S_TNMTraining needs management
HRT1683Table Part Infotype 1683P99S_TNMTraining needs management
HRT1684Table Part Infotype 1684P99S_TNMTraining needs management
P2RF_CCRTPayroll Results: Cumulation of Contributions, Wage TypesPC06HR Payroll: France
P2RF_CPPPayrollResults: Personal hazardous/unpl. work prevent. accntPC06HR Payroll: France
P2RF_CTTPayroll results: contractsPC06HR Payroll: France
P2RF_PASPC06HR Payroll: France
P2RF_PAYMPayroll results: paymentsPC06HR Payroll: France
P2RF_RECOTPayroll Results: Cumulation of ContributionsPC06HR Payroll: France
P2RF_REMPayroll results: remunerationsPC06HR Payroll: France
P2RF_RETAXPC06HR Payroll: France
P2RF_SARPayroll Results: GarnishmentPC06HR Payroll: France
PA0435HR Master Record for Infotype 0435P06INTF_ADPHR Payroll Interface: France (ADP)
T5FDSNCOTICAdjustment of contributions at SIRET levelP06_DSNPackage for Nominative Social Declaration (DSN)
T5FDSNCPPTemp table for PAYFR_RESULT-CPPP06_DSNPackage for Nominative Social Declaration (DSN)
T5FDSNCTTemp table for PAYFR_RESULT-CTP06_DSNPackage for Nominative Social Declaration (DSN)
T5FDSNCUMCOCumulated declared contributions tablePC06HR Payroll: France
T5FDSNPASTemp table for PAYFR_RESULT-PASPC06HR Payroll: France
T5FDSNPAYMTemp table for PAYFR_RESULT-PAYMP06_DSNPackage for Nominative Social Declaration (DSN)
T5FDSNREMTemp table for PAYFR_RESULT-REMP06_DSNPackage for Nominative Social Declaration (DSN)
T5FDSNRETAXTemp table for PAYFR_RESULT-RETAXPC06HR Payroll: France
T5FDSN_PREDMELOGLog for Pre-DMEP06_DSNPackage for Nominative Social Declaration (DSN)
T5FN4DS000N4DS IDs resultPC06HR Payroll: France
T5FPASBAREMEDS: ScalePC06HR Payroll: France
T77TNM_IVCompensation Indirect ValuationP99S_TNMTraining needs management
PA0430HR Master Record, Infotype 0430P06P1
PA0070HR Master Record: Infotype 0070 (Court Orders - GB)PB08HR master data: UK
PA0070HR Master Record: Infotype 0070 (Court Orders - GB)PB08HR master data: UK
PA0071HR Master Record: Infotype 0071 (Pension Funds - GB)PB08HR master data: UK
PA0222HR Master Record for Infotype 0222 (Company Cars GB)PB08HR master data: UK
PA0874HR Master Record: Infotype 0874PB08HR master data: UK
T5GEFSTPEHR GB: Employment Starter (P45,P46) and Pension DetailsPB08HR master data: UK
P2RG_MSAMaternity and Sickness Absences (GB)PC08HR accounting: GB
P2RG_MSAMaternity and Sickness Absences (GB)PC08HR accounting: GB
PAGB_ASHEASHE Return DataPC08HR accounting: GB
T56E4HR: Exception Reporting-Subrule detailsPC08HR accounting: GB
PA0616HR Master Record: Infotype 0616P08P_HERHR Public Sector Great Britain (Higher Education)
PAPBSGB_SWF_PAYSWF: Additional PaymentsP08P1HR Public Sector Great Britain
PAPBSGB_SWF_PAYDSWF: Additional Payments TL3P08P1HR Public Sector Great Britain
PAPBSGB_USA_PENUSS Archive: PEN InterfaceP08P_HERHR Public Sector Great Britain (Higher Education)
PAPBSGB_USS_PENUSS: HR Interface / USS Pensions (IT0071)P08P_HERHR Public Sector Great Britain (Higher Education)
T5GPBS43Lump sum payment for car mileageP08P1HR Public Sector Great Britain
T5GPBS_CARALLOWHRGPBS: Car Allowance for essential car usersP08P1HR Public Sector Great Britain
PA3220HR Master Record: Infotype 3220PB45HR Payroll: Greece
T7GR1HR2Tax Calculations MethodPC45HR Master Data: Greece
T7GR1WTDValues of WagetypesPC45HR Master Data: Greece
T7GR2STDPayroll Groupings & Standard ElementsPC45HR Master Data: Greece
T7GR3LIMInsurance LimitPC45HR Master Data: Greece
T7GR3SCDScale DetailPC45HR Master Data: Greece
T7GR3SIBSocial Insurance BranchesPC45HR Master Data: Greece
T7GR4APDIKA - A.P.D.PC45HR Master Data: Greece
T7GR4E11Special Leave to ERGANH(E11.1)PC45HR Master Data: Greece
T7GR4TAXMonthly Tax FilePC45HR Master Data: Greece
T7GR4TEATEAYET FilePC45HR Master Data: Greece
T7GR4TSMTSMEDE tablePC45HR Master Data: Greece
PA0345HR Master Record: Infotype 0345 (Hong Kong Tax)PB27HR-HK: Master data
PA0346HR Master Record: Infotype 0346 (Contribution plan)PB27HR-HK: Master data
PA0346HR Master Record: Infotype 0346 (Contribution plan)PB27HR-HK: Master data
PA0346HR Master Record: Infotype 0346 (Contribution plan)PB27HR-HK: Master data
PA0346HR Master Record: Infotype 0346 (Contribution plan)PB27HR-HK: Master data
PA0346HR Master Record: Infotype 0346 (Contribution plan)PB27HR-HK: Master data
PA0346HR Master Record: Infotype 0346 (Contribution plan)PB27HR-HK: Master data
PA0346HR Master Record: Infotype 0346 (Contribution plan)PB27HR-HK: Master data
PA0346HR Master Record: Infotype 0346 (Contribution plan)PB27HR-HK: Master data
PA0346HR Master Record: Infotype 0346 (Contribution plan)PB27HR-HK: Master data
PA0346HR Master Record: Infotype 0346 (Contribution plan)PB27HR-HK: Master data
PA0346HR Master Record: Infotype 0346 (Contribution plan)PB27HR-HK: Master data
PA0346HR Master Record: Infotype 0346 (Contribution plan)PB27HR-HK: Master data
PA0347HR Master Record: Infotype 0347 (Entitlement plan)PB27HR-HK: Master data
PA0347HR Master Record: Infotype 0347 (Entitlement plan)PB27HR-HK: Master data
PA0347HR Master Record: Infotype 0347 (Entitlement plan)PB27HR-HK: Master data
PA0347HR Master Record: Infotype 0347 (Entitlement plan)PB27HR-HK: Master data
PA0347HR Master Record: Infotype 0347 (Entitlement plan)PB27HR-HK: Master data
PA0347HR Master Record: Infotype 0347 (Entitlement plan)PB27HR-HK: Master data
PA0347HR Master Record: Infotype 0347 (Entitlement plan)PB27HR-HK: Master data
PA0347HR Master Record: Infotype 0347 (Entitlement plan)PB27HR-HK: Master data
PA0440HR Master Record: Infotype 0440 (Receipts)PB27HR-HK: Master data
T7HK2FContribution plan special rulesPB27HR-HK: Master data
T7HK2FContribution plan special rulesPB27HR-HK: Master data
T7HK2FContribution plan special rulesPB27HR-HK: Master data
T7HK2FContribution plan special rulesPB27HR-HK: Master data
T7HK2JRule details for each contribution rule groupingPB27HR-HK: Master data
T7HK4BFactor & constants for LSP/severance paymentsPB27HR-HK: Master data
T7HK4CMaximum amounts and reckonable YOS for LSP/severance paymentPB27HR-HK: Master data
P2HK_ENTHR-HK: Payroll structure for the MPF/ORSO EntitlementPC27HR payroll accounting: Hong Kong
P2HK_ENTHR-HK: Payroll structure for the MPF/ORSO EntitlementPC27HR payroll accounting: Hong Kong
P2HK_ENTHR-HK: Payroll structure for the MPF/ORSO EntitlementPC27HR payroll accounting: Hong Kong
P2HK_ENTHR-HK: Payroll structure for the MPF/ORSO EntitlementPC27HR payroll accounting: Hong Kong
P2HK_ENTHR-HK: Payroll structure for the MPF/ORSO EntitlementPC27HR payroll accounting: Hong Kong
P2HK_ENTHR-HK: Payroll structure for the MPF/ORSO EntitlementPC27HR payroll accounting: Hong Kong
P2HK_ENTHR-HK: Payroll structure for the MPF/ORSO EntitlementPC27HR payroll accounting: Hong Kong
P2HK_RETIPayroll structure for retroactive accountingPC27HR payroll accounting: Hong Kong
P2HK_RETIPayroll structure for retroactive accountingPC27HR payroll accounting: Hong Kong
P2HK_RETOPayroll structure for retroactive accountingPC27HR payroll accounting: Hong Kong
P2HK_RETOPayroll structure for retroactive accountingPC27HR payroll accounting: Hong Kong
P2HK_SVHR-HK: Payroll structure for the MPF/ORSO ContributionPC27HR payroll accounting: Hong Kong
P2HK_SVHR-HK: Payroll structure for the MPF/ORSO ContributionPC27HR payroll accounting: Hong Kong
P2HK_SVHR-HK: Payroll structure for the MPF/ORSO ContributionPC27HR payroll accounting: Hong Kong
P2HK_SVHR-HK: Payroll structure for the MPF/ORSO ContributionPC27HR payroll accounting: Hong Kong
P2HK_SVHR-HK: Payroll structure for the MPF/ORSO ContributionPC27HR payroll accounting: Hong Kong
P2HK_SVHR-HK: Payroll structure for the MPF/ORSO ContributionPC27HR payroll accounting: Hong Kong
P2HK_SVHR-HK: Payroll structure for the MPF/ORSO ContributionPC27HR payroll accounting: Hong Kong
P2HK_SVHR-HK: Payroll structure for the MPF/ORSO ContributionPC27HR payroll accounting: Hong Kong
P2HK_TAXCUHR-HK: Payroll structure for cumulative tax dataPC27HR payroll accounting: Hong Kong
T7HRA1Bank transfer - interface tablePB58HR Croatia
T7HRTXTax difference calculationPB58HR Croatia
PA0193Pers. master record infotype 0193 (Data of prev. employer H)PB21HR master data: Hungary
PA0226Garnishments (H)PB21HR master data: Hungary
PA0284PB21HR master data: Hungary
PA0285PB21HR master data: Hungary
PA0286SI child's supplementary data (H)PB21HR master data: Hungary
PA0307Additional data for taxationPB21HR master data: Hungary
PA0308PB21HR master data: Hungary
PA0441Corrections for reports (Hungary)PB21HR master data: Hungary
PA0514Materials issuedPB21HR master data: Hungary
PA0660HR master record infortype 0660PB21HR master data: Hungary
P2RH_ADOStructure of table ADOPC21HR accounting: Hungary
P2RH_HU_ADIFDifferences spanning over year-limitPC21HR accounting: Hungary
P2RH_HU_CDIFDifferences spanning over year-limitPC21HR accounting: Hungary
P2RH_HU_DDIFDifferences spanning over year-limitPC21HR accounting: Hungary
P2RH_HU_EDIFDifferences spanning over year-limitPC21HR accounting: Hungary
P2RH_HU_HKIFP21PBPC21HR accounting: Hungary
P2RH_HU_HKIFP21PBPC21HR accounting: Hungary
P2RH_HU_JKORDifferences spanning over year-limitPC21HR accounting: Hungary
P2RH_HU_KDIFDifferences spanning over year-limitPC21HR accounting: Hungary
P2RH_HU_MEMBP21MBPC21HR accounting: Hungary
P2RH_HU_NRBEIrregular incomes from infotype 3234PC21HR accounting: Hungary
P2RH_HU_NRENP21PAPC21HR accounting: Hungary
P2RH_HU_ODIFDifferences spanning over year-limitPC21HR accounting: Hungary
PA0163Taxation (H)PC21HR accounting: Hungary
PA0643Personnel master record: 0643 infotypeP21PSHR Public Sector Hungary
PA3234HR master record, infotype 3234P21PSHR Public Sector Hungary
PA3261Commission contracts HP21PSHR Public Sector Hungary
PA3262Payments for persons with commission HP21PSHR Public Sector Hungary
PA3266HR master record, infotype 3266P21PSHR Public Sector Hungary
PA3267HR master record, infotype 3267P21PSHR Public Sector Hungary
T5H11Minimum contribution base - reported employeesPC21HR accounting: Hungary
T5H1WCorrection data for form K32PC21HR accounting: Hungary
T5H42Reported GYED sequence numberPC21HR accounting: Hungary
T5H43Reported TGYS numbersPC21HR accounting: Hungary
T5H4OReported "closed incapacities to work"PC21HR accounting: Hungary
T5H81TRegistered employment relationships (multiple employer)PC21HR accounting: Hungary
T5H82TRegistered employment relationships (multiple employer)PC21HR accounting: Hungary
T5H83Data of other legal relationshipsPC21HR accounting: Hungary
T5H98Solidarity taxPC21HR accounting: Hungary
T5HNRHU_NREN payroll table data of the "current month"PC21HR accounting: Hungary
T5HPBS100Amount of international per diem for business tripP21PSHR Public Sector Hungary
T5HPBS_HAVIBONTComm. - payments monthly breakdown by personsP21PSHR Public Sector Hungary
T5HSESheet no. 12 Self-checkPC21HR accounting: Hungary
PA0319Indonesia Private InsurancesPB34HR master data: Indonesia
PA0362HR Master Record: Infotype Membership for Indonesia (0362)PB34HR master data: Indonesia
PA0694PB34HR master data: Indonesia
PA0694PB34HR master data: Indonesia
T7ID13Insurance Scheme Levels and Contributions (Indonesia)PB34HR master data: Indonesia
T7ID2GTax and Grsup grouping -- IDPB34HR master data: Indonesia
T7ID2LTax Constant Amounts (Indonesia)PB34HR master data: Indonesia
T7ID2RIndonesian Tax RatesPB34HR master data: Indonesia
T7IDRWRegion Codes and their minimum wagesPB34HR master data: Indonesia
P2IS_INSPayroll Indonesia JAMSOSTEK & Other Insurance DataPC34HR payroll accounting: Indonesia
P2IS_RETIPayroll structure for retroactive accountingPC34HR payroll accounting: Indonesia
P2IS_RETIPayroll structure for retroactive accountingPC34HR payroll accounting: Indonesia
P2IS_RETOPayroll structure for retroactive accountingPC34HR payroll accounting: Indonesia
P2IS_RETOPayroll structure for retroactive accountingPC34HR payroll accounting: Indonesia
P2IS_TAXPayroll Indonesia Tax DataPC34HR payroll accounting: Indonesia
P2IS_TAXCUPayroll structure for cumulative tax data (Indonesia)PC34HR payroll accounting: Indonesia
PA0359HR Master Record : Infotype 0359 (PRSI Ireland)PB11HR master data: Ireland
PA0361HR Master Record : Infotype 0361 (Pensions Admin. - IE)PB11HR master data: Ireland
PA0386HR Master Record: Infotype 0386 (VHI Scheme)PB11HR master data: Ireland
PA0387HR Master Record : Infotype 0387 (Starter's Details)PB11HR master data: Ireland
T7IE2Irish Tax TablePB11HR master data: Ireland
T7IE3Irish PRSI TablePB11HR master data: Ireland
T7IE4Emergency Tax TablePB11HR master data: Ireland
T7IEPPension schemes IrelandPB11HR master data: Ireland
P2IE_IETAXPayroll Results : Tax (IE)PC11HR payroll: Ireland
P2IE_IEUSCHR IE: Irish Payroll Cluster for Universal Social Cont (USC)PC11HR payroll: Ireland
P2IE_PENSPension Funds (IE)PC11HR payroll: Ireland
P2IE_PRSIPayroll Result: PRSI (IE)PC11HR payroll: Ireland
T7IEPRDPY-IE: PRD RatesPC11HR payroll: Ireland
PA0580Previous Employment Tax DetailsPB40HR master data: India
PA0581HousingPB40HR master data: India
PA0582ExemptionsPB40HR master data: India
PA0583Car and ConveyancePB40HR master data: India
PA0584Income from other sourcesPB40HR master data: India
PA0585Section 80 - Tax ExemptionsPB40HR master data: India
PA0586Section 88 - Tax rebatePB40HR master data: India
PA0587Provident Fund contributionPB40HR master data: India
PA0589Individual ReimbursementsPB40HR master data: India
PA0590Furnishing Scheme - IndiaPB40HR master data: India
T7INA7Reimbursements Allowances and Perks - base slabsPB40HR master data: India
T7INA9Reimbursement Allowances Perks - eligibility and calculatiPB40HR master data: India
T7INB7Basic SlabsPB40HR master data: India
T7INC5Perk value of carPB40HR master data: India
T7INC7Eligibility for car schemes(COCS/OYCS)PB40HR master data: India
T7IND5Dearness alloowance basic slab detailsPB40HR master data: India
T7IND7Dearness allowance calculation rulesPB40HR master data: India
T7IND9Dearness allowance consumer price index slabsPB40HR master data: India
T7INF3Statutory rates for Provident fundPB40HR master data: India
T7INI0Investment category limitsPB40HR master data: India
T7INI4Investment limitsPB40HR master data: India
T7INI7Sub section limitsPB40HR master data: India
T7INI9Subsection division detailsPB40HR master data: India
T7INJ3HR-IN: Loans Eligibility checks and limitsPB40HR master data: India
T7INJ7Define slab rates for loansPB40HR master data: India
T7INM1Slab codes of Minimum wage for Bonus ActPB40HR master data: India
T7INP4Professional tax ratesPB40HR master data: India
T7INR3Constants related to HRA codePB40HR master data: India
T7INT3Taxation slabsPB40HR master data: India
T7INT9Taxability of wage typesPB40HR master data: India
T7INU5Contribution Value for Each SlabPB40HR master data: India
T7INW3Labour welfare fund ratesPB40HR master data: India
T7INY1Round off recoveryPB40HR master data: India
P2IN_CCOPayroll India - Car and ConveyancePC40HR payroll accounting: India
P2IN_EPFPayroll structure for Provident Fund InfotypePC40HR payroll accounting: India
P2IN_EXMPayroll structure for exemptionsPC40HR payroll accounting: India
P2IN_HFSPayroll India - Hard Furnishing SchemePC40HR payroll accounting: India
P2IN_HRAHousing(HRA/CLA/COA) detailsPC40HR payroll accounting: India
P2IN_IOSIncome from other sourcesPC40HR payroll accounting: India
P2IN_PETPayroll structure for previous employment tax detailsPC40HR payroll accounting: India
P2IN_S80Section 80 ContributionsPC40HR payroll accounting: India
P2IN_S88Payroll India Sec88 Investment DetailsPC40HR payroll accounting: India
P2IN_S89Payroll structure for section 89(1)PC40HR payroll accounting: India
PA0659HR master record for INAIL administrationPB15HR master data, local development: Italy
T5ITF24Archive F24PB15HR master data, local development: Italy
T5ITF24CTable for F24 compensationsPB15HR master data, local development: Italy
T5ITR2Regional Taxation - Corrective MeasuresPB15HR master data, local development: Italy
P2RI_CIG_AUTHRHC: authorization for absencesPC15HR payroll: Italy
P2RI_IPCUMRI cluster structure for cumulations (IPCUM)PC15HR payroll: Italy
P2RI_IPCUMRI cluster structure for cumulations (IPCUM)PC15HR payroll: Italy
P2RI_ITIOTRI cluster structure for retroactive accountingPC15HR payroll: Italy
P2RI_ITIOTRI cluster structure for retroactive accountingPC15HR payroll: Italy
P2RI_SPPayroll Results: Special PaymentsPC15HR payroll: Italy
PA3214HR Master Record: Infotype 3214P15P1HR Public Sector Italy
T5ITBSSpecial BonusPC15HR payroll: Italy
T5ITIN0INAIL table to update group dataPC15HR payroll: Italy
T5ITIN1Contribution INAIL tablePC15HR payroll: Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ1Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITJ2Juridical periodical payments (Italy)P15P1HR Public Sector Italy
T5ITUAUser Data Table of the Company for Report/ Legal FormPC15HR payroll: Italy
T5ITUIUser Data Table for Report / Legal FormPC15HR payroll: Italy
T5ITUI_2User Data Table for Report / Legal FormPC15HR payroll: Italy
PA0560HR Master Record: Infotype 0560PB22HR master data: Japan
PA0560HR Master Record: Infotype 0560PB22HR master data: Japan
PA0851HR Master Record: Infotype 0851PB22_SHUKKOShukko
PA0852HR Master Record: Infotype 0852PB22_SHUKKOShukko
PA3203HR Master Record: Infotype 3203PB22HR master data: Japan
PA3203HR Master Record: Infotype 3203PB22HR master data: Japan
PA3203HR Master Record: Infotype 3203PB22HR master data: Japan
PA3203HR Master Record: Infotype 3203PB22HR master data: Japan
PA3203HR Master Record: Infotype 3203PB22HR master data: Japan
PA3203HR Master Record: Infotype 3203PB22HR master data: Japan
PA3203HR Master Record: Infotype 3203PB22HR master data: Japan
PA3203HR Master Record: Infotype 3203PB22HR master data: Japan
PA3203HR Master Record: Infotype 3203PB22HR master data: Japan
PA3203HR Master Record: Infotype 3203PB22HR master data: Japan
PA3203HR Master Record: Infotype 3203PB22HR master data: Japan
PA3203HR Master Record: Infotype 3203PB22HR master data: Japan
PA3203HR Master Record: Infotype 3203PB22HR master data: Japan
PA3204HR Master Record: Infotype 3204PB22HR master data: Japan
PA3204HR Master Record: Infotype 3204PB22HR master data: Japan
PA3204HR Master Record: Infotype 3204PB22HR master data: Japan
PA3204HR Master Record: Infotype 3204PB22HR master data: Japan
PA3204HR Master Record: Infotype 3204PB22HR master data: Japan
PA3204HR Master Record: Infotype 3204PB22HR master data: Japan
PA3204HR Master Record: Infotype 3204PB22HR master data: Japan
PA3204HR Master Record: Infotype 3204PB22HR master data: Japan
PA3204HR Master Record: Infotype 3204PB22HR master data: Japan
PA3204HR Master Record: Infotype 3204PB22HR master data: Japan
PA3204HR Master Record: Infotype 3204PB22HR master data: Japan
PA3239HR Master Record: Infotype 3239PB22HR master data: Japan
T5JLGPremium amount for employment insurancePB22HR master data: Japan
T7JPSK_CCRLShukko Cost Charging RulesPB22_SHUKKOShukko
P2RJ_HEITPayroll Results: Hei Ran Results TablePC22HR accounting: Japan
P2RJ_HEITPayroll Results: Hei Ran Results TablePC22HR accounting: Japan
P2RJ_JP_CPTPayroll result: Retirement Benefit ResultPC22HR accounting: Japan
P2RJ_KGTKijungai time occured in for-period with Position infoPC22HR accounting: Japan
P2RJ_MATCumulation Table for Flexible PayrollPC22HR accounting: Japan
P2RJ_MSTPayroll result: Monthly socail insurance tablePC22HR accounting: Japan
P2RJ_RETTAXPayroll Results: Detailed Retirement Tax InfomationPC22HR accounting: Japan
P2RJ_RET_INFOPayroll Results: Retirement Information TablePC22HR accounting: Japan
PA0888HR Master Record: Infotype 0888PB22_CPMaster data: Japan Pension Plan
PA0889HR Master Record: Infotype 0889PB22_CPMaster data: Japan Pension Plan
PA0903HR Master Record: Infotype 0903PB22_CPMaster data: Japan Pension Plan
T7JPBP_UPTBLPoint Unit Price Value TablePB22_CPMaster data: Japan Pension Plan
T7JPCP_CLBSPARCalculation Basis ParameterPB22_CPMaster data: Japan Pension Plan
T7JPCP_CLFCTBLCalculation Factor Parameter Value TablePB22_CPMaster data: Japan Pension Plan
T7JPCP_PRFCTBLPremium Amount/Rate Parameters Value TablePB22_CPMaster data: Japan Pension Plan
PA0538HR Master Record: Infotype 0538PB41HR master data: Korea
PA0538HR Master Record: Infotype 0538PB41HR master data: Korea
PA0698HR Master Record: Infotype 0698PB41HR master data: Korea
PA0858HR Master Record: Infotype 0858PB41HR master data: Korea
PA0858HR Master Record: Infotype 0858PB41HR master data: Korea
PB0858Applicant data infotype 0858 (model)PB41HR master data: Korea
PB0858Applicant data infotype 0858 (model)PB41HR master data: Korea
P2KR_KRSP1Payroll Results Korea: Separation payroll II (Master Data)PC41HR Payroll: Korea
P2KR_KRSP1Payroll Results Korea: Separation payroll II (Master Data)PC41HR Payroll: Korea
P2KR_KRSP2Payroll Results Korea: Separation payroll IIPC41HR Payroll: Korea
PA3362HR Master Record: Infotype 3362PBKWHR Master Data - Kuwait
T7KW06Home Airport (KW)(obsolete)PBKWHR Master Data - Kuwait
T7KW11Home Airport (KW) for Leave Passage by Tickets (obsolete)PBKWHR Master Data - Kuwait
P2KZ_FUPStructure for Table FUP - Future PeriodsPCKZHR accounting: Kazakhstan
P2KZ_FUPStructure for Table FUP - Future PeriodsPCKZHR accounting: Kazakhstan
P2KZ_KZAVCumulations for Calculation of AveragesPCKZHR accounting: Kazakhstan
P2KZ_KZAVCumulations for Calculation of AveragesPCKZHR accounting: Kazakhstan
T77PAYKZBTBank Transfer Table Image (BTKZ)PCKZHR accounting: Kazakhstan
PA0370Master data: Infotype 0370 (INFONAVIT credit data)PB32Human Resources master data - Mexico
PA0370Master data: Infotype 0370 (INFONAVIT credit data)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
PA0371Master Data: Infotype 0371 (Tax on previous employment)PB32Human Resources master data - Mexico
P2MX_9LRERSLRetroactive Accounting ResultsPC32Payroll - Mexico
P2MX_LNCTMX Loans ProcessingPC32Payroll - Mexico
P2MX_MXCRTPayroll result: Cumulated results Tax MXPC32Payroll - Mexico
P2MX_TAX_ITAdditional tax data included for calculationPC32Payroll - Mexico
PA0372Master data: Infotype 0372 (Integrated daily wage)PC32Payroll - Mexico
PA0427Debts by garnishmentPC32Payroll - Mexico
T77PAYMX_CFDI_STCFDi Digital Tax StampPC32Payroll - Mexico
T7MX12Tax tablesPC32Payroll - Mexico
T7MX13Tax allowance tablePC32Payroll - Mexico
T7MX14Wage credit tablePC32Payroll - Mexico
T7MX62Minimum wages of economic zonesPC32Payroll - Mexico
PA0756Public Sector Loan Infotype 0756 (Mexico)P32P1Public Sector ISSSTE development for Mexico
PA0756Public Sector Loan Infotype 0756 (Mexico)P32P1Public Sector ISSSTE development for Mexico
PAPBSMXBQWISSSTE - Basic Quotation WageP32P1Public Sector ISSSTE development for Mexico
PAPBSMXSARCSAR current resultP32P1Public Sector ISSSTE development for Mexico
PAPBSMXSARLTable with the last information sent for ConsarP32P1Public Sector ISSSTE development for Mexico
PAPBSMXSARPSAR previous resultP32P1Public Sector ISSSTE development for Mexico
PA0196HR Master Record:Infotype 0196 (Employee Provident Fund MY)PB14HR master data: Malaysia
PA0196HR Master Record:Infotype 0196 (Employee Provident Fund MY)PB14HR master data: Malaysia
PA0198Sheduled Tax Deductuion MalaysiaPB14HR master data: Malaysia
PA0199Tax deduction CP38 / Additional amt / Bonus - MalaysiaPB14HR master data: Malaysia
PA0547BIK Infotype for MalaysiaPB14HR master data: Malaysia
T5LIRSocial Insurance Contributions for MalaysiaPB14HR master data: Malaysia
T5LIRSocial Insurance Contributions for MalaysiaPB14HR master data: Malaysia
T5LSRSOCSO contributions for MalaysiaPB14HR master data: Malaysia
T5LSRSOCSO contributions for MalaysiaPB14HR master data: Malaysia
P2RL_EPFPayroll result: EPF (Malaysia)PC14HR accounting: Malaysia
P2RL_EPFPayroll result: EPF (Malaysia)PC14HR accounting: Malaysia
P2RL_TAXEPayroll result: Tax (Malaysia) ExemptionsPC14HR accounting: Malaysia
T5LRNTax Reporting Receipt no tablePC14HR accounting: Malaysia
PA0110HR Master Record: Infotype 0110 (Pensions NL)PB05HR Master Data: Netherlands
PA0127HR Master Record: Infotype 0127 (Commuter Traffic NL)PB05HR Master Data: Netherlands
PA0317HR Master Record: Infotype 0317 (Special Provisions)PB05HR Master Data: Netherlands
PA3442HR Master Record: Infotype 3442PB05HR Master Data: Netherlands
T5N4HHome Allowance ConfigurationPB05HR Master Data: Netherlands
T5N4LHome Allowance Configuration - Define LimitsPB05HR Master Data: Netherlands
T5N4MOffice Allowance Configuration - Define LimitsPB05HR Master Data: Netherlands
T5N4OOffice Allowance ConfigurationPB05HR Master Data: Netherlands
PA0646HR Master Record: Infotype 0022 (Education)P05FPension fund Netherlands
PA0646HR Master Record: Infotype 0022 (Education)P05FPension fund Netherlands
T5NDAP05FPension fund Netherlands
T5NDAP05FPension fund Netherlands
T5NDBP05FPension fund Netherlands
T5NDBP05FPension fund Netherlands
T5NDCP05FPension fund Netherlands
T5NDCP05FPension fund Netherlands
T5NDDP05FPension fund Netherlands
T5NDDP05FPension fund Netherlands
T5NDEP05FPension fund Netherlands
T5NDEP05FPension fund Netherlands
T5NE9P05FPension fund Netherlands
P05TPRNL_LP_ERPension Return: Employer Return on Legal Person LevelP05THR Payroll: The Netherlands
P05TPRNL_LP_SALDPension Return � Saldo Return on Legal Person levelP05THR Payroll: The Netherlands
P05T_LA_PREDMEWage Return: Pre-DME for payment of Wage TaxP05THR Payroll: The Netherlands
P05T_WCR_SIMUWCR SimulationP05THR Payroll: The Netherlands
P05T_WCR_SIMUWCR SimulationP05THR Payroll: The Netherlands
P05T_WCR_SIMUWCR SimulationP05THR Payroll: The Netherlands
P05T_WCR_SIMUWCR SimulationP05THR Payroll: The Netherlands
P05T_WCR_SIMUWCR SimulationP05THR Payroll: The Netherlands
P05T_WCR_SIMUWCR SimulationP05THR Payroll: The Netherlands
P05T_WCR_SIMUWCR SimulationP05THR Payroll: The Netherlands
P05T_WCR_SIMUWCR SimulationP05THR Payroll: The Netherlands
P05T_WCR_SIMUWCR SimulationP05THR Payroll: The Netherlands
P05T_WCR_SIMUWCR SimulationP05THR Payroll: The Netherlands
P05T_WCR_SIMUWCR SimulationP05THR Payroll: The Netherlands
P05T_WCR_SIMUWCR SimulationP05THR Payroll: The Netherlands
P05T_WCR_SIMUWCR SimulationP05THR Payroll: The Netherlands
P05T_WCR_SIMUWCR SimulationP05THR Payroll: The Netherlands
P05T_WCR_SIMUWCR SimulationP05THR Payroll: The Netherlands
P2RN_GWPayroll Results: Garnishment WagesPC05HR Payroll: Netherlands
P2RN_NSR0Payroll Results: Special Provisions (NL)PC05HR Payroll: Netherlands
P2RN_NWVPayroll Results: Commuter Traffic (NL)PC05HR Payroll: Netherlands
P2RN_PKPayroll Result: Pension ModulePC05HR Payroll: Netherlands
P2RN_SPPayroll Results: Special PaymentsPC05HR Payroll: Netherlands
T5N2OPremium Reductions (NL)PC05HR Payroll: Netherlands
PA0173Tax card informationPB20HR master data: Norway
PA0419HR Master record: Manual tax reporting information - NorwayPB20HR master data: Norway
T5V2BUnion tablePB20HR master data: Norway
P2RV_RETPRETP Structure NorwayPC20HR accounting: Norway
P2RV_SCRTSCRT NorwayPC20HR accounting: Norway
P2RV_STST for Norway (Cluster for tax)PC20HR accounting: Norway
PA0310Superannuation NZPB43HR master data: New Zealand
PA0311Leave Adjustments - NZPB43HR master data: New Zealand
PA0312Leave History Adjustments NZPB43HR master data: New Zealand
HNZLVPAYTable for modified LVPAY cluster table recordsPC43HR accounting: New Zealand
P2NZ_ACCRCALCLeave Accrual on Term CalculationPC43HR accounting: New Zealand
P2NZ_LVACCPayroll Result: Leave Accruals LVACC - NZPC43HR accounting: New Zealand
P2NZ_LVTAKPayroll Result: Leave Taken LVTAK - NZPC43HR accounting: New Zealand
P2NZ_NZSUPPayroll Result: Superannuation (NZSUP) - NZPC43HR accounting: New Zealand
P2NZ_RETPPayroll structure NZ: RETP TablePC43HR accounting: New Zealand
P2NZ_SALSACSalary Sacrifice DetailsPC43HR accounting: New Zealand
P2NZ_SALSACSalary Sacrifice DetailsPC43HR accounting: New Zealand
P2NZ_TAXPPayroll Result: Taxation TAXP - NZPC43HR accounting: New Zealand
PT0416Time Quota Compensation Infotype: Database TablePC43HR accounting: New Zealand
PT2001HR Time Record: Infotype 2001 (Absences)PC43HR accounting: New Zealand
T7NZTETaxation Earner Premium NZPC43HR accounting: New Zealand
T7NZTIIndependent Earner Tax Credit NZPC43HR accounting: New Zealand
T7NZTLTaxation Student Loan Deduction NZPC43HR accounting: New Zealand
T7NZTRTaxation Rebates NZPC43HR accounting: New Zealand
T7NZTSNational Superannuitant Surcharge Codes NZPC43HR accounting: New Zealand
T7NZTXTax Codes NZPC43HR accounting: New Zealand
T7OM03OMAN Health Insurance Premium & Eligibility TablePBOMHR Master Data - Oman
T7OM04OMAN Life Insurance PremiumPBOMHR Master Data - Oman
T7OM19Home Airport Rates for Leave Passage by Tickets (obsolete)PBOMHR Master Data - Oman
T7OM21Home Airport Rates for Leave Passage by Amount (obsolete)PBOMHR Master Data - Oman
P2OM_INS_OMPayroll Result: Oman Health & Life Insurance InformationPCOMPayroll - Oman
T7PHTPTax Projection Method detailsPB48HR master data: Philippines
PA0657HR Master Record: Infotype 0657PB46HR Poland
PA0859HR master data: Infotype 0859PB46HR Poland
PA0338HR Master Record: Infotype 0338 (Absence pay.clearing - PT)PB19HR master data: Portugal
T5P1PHR-PT: Table of tax ratesPB19HR master data: Portugal
T5P1RHR-PT: Retention rate table (Obsolete)PB19HR master data: Portugal
P2RP_MFHR-PT: Payroll Results: Membership feesPC19HR settlement: Portugal
P2RP_SCRTHR-PT: Cumulated result table (Legal entity dependent)PC19HR settlement: Portugal
P2RP_VAHR-PT: Payroll Results: Vacation allowance grouping (VA)PC19HR settlement: Portugal
T5PBFAWage type determination to consider for the allowancePC19HR settlement: Portugal
PA0896HR Master Record: Infotype 0896 (ADSE Treatment - PT)PB19PS
PA0899Master record: Infotype 0899PB19PS
T5PPBS2FFamily allowance dataPB19PS
T5PPBS6TADSE Treatment TypePB19PS
T5PPBS8BGrouping index 100PB19PS
PA3305HR Master Record: Infotype 3305PBQAHR Master Data - Qatar
PA3307HR Master Record: Infotype 3307PBQAHR Master Data - Qatar
PA3307HR Master Record: Infotype 3307PBQAHR Master Data - Qatar
PA3317HR Master Record: Infotype 3317PBQAHR Master Data - Qatar
PA3318HR Master Record: Infotype 3318PBQAHR Master Data - Qatar
PA3349HR Master Record: Infotype 3349PBQAHR Master Data - Qatar
PA3349HR Master Record: Infotype 3349PBQAHR Master Data - Qatar
PB3305Applicant data infotype 3305 (model)PBQAHR Master Data - Qatar
PB3307Applicant data infotype 3307 (model)PBQAHR Master Data - Qatar
PB3307Applicant data infotype 3307 (model)PBQAHR Master Data - Qatar
T7QA02Qatar Statutory Social Insurance Contribution TablePBQAHR Master Data - Qatar
T7QA04Qatar Private Social Insurance Contribution TablePBQAHR Master Data - Qatar
T7QA101Allowances during terminationPBQAHR Master Data - Qatar
T7QA11Home Airport (QA) (Obsolete)PBQAHR Master Data - Qatar
T7QA41Loan grouping rule configuration for QatarPBQAHR Master Data - Qatar
T7QA41Loan grouping rule configuration for QatarPBQAHR Master Data - Qatar
T7QA41Loan grouping rule configuration for QatarPBQAHR Master Data - Qatar
T7QA41Loan grouping rule configuration for QatarPBQAHR Master Data - Qatar
T7QA67Default Cost for Expense TypePBQAHR Master Data - Qatar
T7QA72Document Renewal ProvisionPBQAHR Master Data - Qatar
T7QA83Employee Received Petty Cash QAPBQAHR Master Data - Qatar
T7QA84Qatar Statutory Social Insurance Fund TypePBQAHR Master Data - Qatar
T7QAW7CEligibility of Salary ComponentsPBQAHR Master Data - Qatar
P2QA_PS_QAPayroll Result: Pension Data for QAPCQAPayroll - Qatar
P2QA_SR_QAPayroll Result: Pension Service Repayment Data for QAPCQAPayroll - Qatar
PA3335HR Master Record: Infotype 3335PQAP1HR Master Data - Pubic Sector Qatar
PA3339HR Master Record: Infotype 3339PQAP1HR Master Data - Pubic Sector Qatar
PA3339HR Master Record: Infotype 3339PQAP1HR Master Data - Pubic Sector Qatar
PA3339HR Master Record: Infotype 3339PQAP1HR Master Data - Pubic Sector Qatar
T7QAPBS12Periodic Increment Evaluation by Appraisal ResultPQAP1HR Master Data - Pubic Sector Qatar
T7QAPBS23Instalment Information of Service DurationPQAP1HR Master Data - Pubic Sector Qatar
T7QAPBS_SCHOOLSSchool Data CustomisingPQAP1HR Master Data - Pubic Sector Qatar
PA0518HR Master Record: Infotype 0518PC61HR Romania
T7RO1PInsurance result table - Person 1:1 with RGDIRPC61HR Romania
T7ROA1Bank transfer - interface tablePC61HR Romania
T7ROA2Insurance result table - Person 1:1 with RGDIRPC61HR Romania
T7ROA3Insurance result table - Person 1:1 with RGDIRPC61HR Romania
T7ROA4Sick leaves - Person 1:1 with RGDIRPC61HR Romania
T7ROA5Changes of external transfers (IT11)PC61HR Romania
T7ROA6Contr. H - received/deducted amount from the authoritiesPC61HR Romania
T7ROA8Contr. G - Deducted AmountPC61HR Romania
PA0297HR Master Record: Infotype 0297 Work conditionsPB33HR master data : Russia
PA3273HR Master Record: Infotype 3273PB33HR master data : Russia
T7RUFAFlexible Employee Payroll Data (Totals)PB33HR master data : Russia
T7RUPA0022PA0022 CopyPB33HR master data : Russia
P2UR_AVER_PERSONFrozen Average Values in Payroll Result (Person)PC33HR accounting : Russia
P2UR_FUPtable FUP - future periodsPC33HR accounting : Russia
P2UR_FUPtable FUP - future periodsPC33HR accounting : Russia
P2UR_RUAVECumulations for calculation of averagesPC33HR accounting : Russia
P2UR_RUAVECumulations for calculation of averagesPC33HR accounting : Russia
P2UR_RUAV_PERSONCumulations for calculation of averages (Person)PC33HR accounting : Russia
P2UR_RUAV_PERSONCumulations for calculation of averages (Person)PC33HR accounting : Russia
P2UR_RURESRussian StatusesPC33HR accounting : Russia
P2UR_RURTPayroll Results: Results TablePC33HR accounting : Russia
P2UR_RURTPayroll Results: Results TablePC33HR accounting : Russia
P2UR_RURT_PERSONResults Table (Person)PC33HR accounting : Russia
P2UR_RURT_PERSONResults Table (Person)PC33HR accounting : Russia
P2AA_OH_SAPayroll Result: OH Data for KSAPC24Enhancements Payroll and Time Mgmt KSA
P2AA_PS_SAPayroll Result: Pension Data for KSAPC24Enhancements Payroll and Time Mgmt KSA
PA3312HR Master Record: Infotype 3312PB24Enhancements Master Data KSA
PA3312HR Master Record: Infotype 3312PB24Enhancements Master Data KSA
PA3312HR Master Record: Infotype 3312PB24Enhancements Master Data KSA
PA3312HR Master Record: Infotype 3312PB24Enhancements Master Data KSA
PA3312HR Master Record: Infotype 3312PB24Enhancements Master Data KSA
PA3312HR Master Record: Infotype 3312PB24Enhancements Master Data KSA
T7SA09Home AirportPB24Enhancements Master Data KSA
T7SA13KSA GOSI Contribution TablePB24Enhancements Master Data KSA
T7SA34Occupational Hazard Compensation ModelPB24Enhancements Master Data KSA
T7SA36Occupational Hazard Compensation AllowancePB24Enhancements Master Data KSA
T7SA53KSA: End Of Service GroupsPC24Enhancements Payroll and Time Mgmt KSA
PA3320HR Master Record: Infotype 3320P24P1Public Sector KSA
PA3320HR Master Record: Infotype 3320P24P1Public Sector KSA
PA3321HR Master Record: Infotype 3321P24P1Public Sector KSA
PA3405HR Master Record: Infotype 3405P24P1Public Sector KSA
T7SAPBS10Representation allowance according to Job & CategoryP24P1Public Sector KSA
PA0273HR Master Record: Infotype 0273 (Tax - SE)PB23HR master data: Sweden
PA0273HR Master Record: Infotype 0273 (Tax - SE)PB23HR master data: Sweden
PA0273HR Master Record: Infotype 0273 (Tax - SE)PB23HR master data: Sweden
PA0274HR Master Record: Infotype 0274 (Insurance - SE)PB23HR master data: Sweden
PA0275HR Master Record: Infotype 0275 (Garnishment - SE)PB23HR master data: Sweden
PA0276HR Master Record: Infotype 0276 (OPIS - SE)PB23HR master data: Sweden
PA0276HR Master Record: Infotype 0276 (OPIS - SE)PB23HR master data: Sweden
PA0276HR Master Record: Infotype 0276 (OPIS - SE)PB23HR master data: Sweden
PA0276HR Master Record: Infotype 0276 (OPIS - SE)PB23HR master data: Sweden
PA0276HR Master Record: Infotype 0276 (OPIS - SE)PB23HR master data: Sweden
PA0276HR Master Record: Infotype 0276 (OPIS - SE)PB23HR master data: Sweden
PA0276HR Master Record: Infotype 0276 (OPIS - SE)PB23HR master data: Sweden
PA0276HR Master Record: Infotype 0276 (OPIS - SE)PB23HR master data: Sweden
PA0276HR Master Record: Infotype 0276 (OPIS - SE)PB23HR master data: Sweden
PA0277HR Master Record: Infotype 0277 (Exceptions - SE)PB23HR master data: Sweden
T5S3HOne-off Tax (SE) - Obsolete from 01.01.2005PB23HR master data: Sweden
T5S6BOPIS Scale Master (SE)PB23HR master data: Sweden
P2RS_SEXCPayroll result: Exceptions (SE)PC23HR accounting: Sweden
P2RS_SFORSPayroll result: Insurances (SE)PC23HR accounting: Sweden
P2RS_SINLPayroll result: Garnishment (SE)PC23HR accounting: Sweden
P2RS_SOPISPayroll result: OPIS (SE)PC23HR accounting: Sweden
P2RS_SOPISPayroll result: OPIS (SE)PC23HR accounting: Sweden
P2RS_SOPISPayroll result: OPIS (SE)PC23HR accounting: Sweden
P2RS_SOPISPayroll result: OPIS (SE)PC23HR accounting: Sweden
P2RS_SOPISPayroll result: OPIS (SE)PC23HR accounting: Sweden
P2RS_SOPISPayroll result: OPIS (SE)PC23HR accounting: Sweden
P2RS_SOPISPayroll result: OPIS (SE)PC23HR accounting: Sweden
P2RS_SOPISPayroll result: OPIS (SE)PC23HR accounting: Sweden
P2RS_SOPISPayroll result: OPIS (SE)PC23HR accounting: Sweden
P2RS_SSKATPayroll result: Tax (SE)PC23HR accounting: Sweden
P2RS_SSKATPayroll result: Tax (SE)PC23HR accounting: Sweden
P2RS_SSKATPayroll result: Tax (SE)PC23HR accounting: Sweden
PA0181HR Master Record: Infotype 0181 [Add. Funds] (SG)PB25HR Singapore: Master data
PA0181HR Master Record: Infotype 0181 [Add. Funds] (SG)PB25HR Singapore: Master data
PA0181HR Master Record: Infotype 0181 [Add. Funds] (SG)PB25HR Singapore: Master data
PA0181HR Master Record: Infotype 0181 [Add. Funds] (SG)PB25HR Singapore: Master data
PA0181HR Master Record: Infotype 0181 [Add. Funds] (SG)PB25HR Singapore: Master data
PA0181HR Master Record: Infotype 0181 [Add. Funds] (SG)PB25HR Singapore: Master data
PA0181HR Master Record: Infotype 0181 [Add. Funds] (SG)PB25HR Singapore: Master data
PA0186HR Master Record: Infotype 0186 [Social Insurance] (SG)PB25HR Singapore: Master data
PA0186HR Master Record: Infotype 0186 [Social Insurance] (SG)PB25HR Singapore: Master data
PA0186HR Master Record: Infotype 0186 [Social Insurance] (SG)PB25HR Singapore: Master data
PA0186HR Master Record: Infotype 0186 [Social Insurance] (SG)PB25HR Singapore: Master data
PA3364HR Master Record: Infotype 3364PB25HR Singapore: Master data
T5R1CCPF Contribution rate of Soc. Insurance / SGPB25HR Singapore: Master data
T5R1FAdditional Funds/SGPB25HR Singapore: Master data
T5R6DConfigure the Overtime EligibilityPB25HR Singapore: Master data
P2RR_ADDFPayresult: Additional Funds/SGPC25HR Singapore: Accounting
P2RR_ADDFPayresult: Additional Funds/SGPC25HR Singapore: Accounting
P2RR_ADDFPayresult: Additional Funds/SGPC25HR Singapore: Accounting
P2RR_ADDFPayresult: Additional Funds/SGPC25HR Singapore: Accounting
P2RR_ADDFPayresult: Additional Funds/SGPC25HR Singapore: Accounting
P2RR_ADDFPayresult: Additional Funds/SGPC25HR Singapore: Accounting
P2RR_ADDFPayresult: Additional Funds/SGPC25HR Singapore: Accounting
P2RR_RMPayroll Results: Table for Master data (SG)PC25HR Singapore: Accounting
P2RR_SPPayroll Results: Special PaymentsPC25HR Singapore: Accounting
P2RR_SRTPayroll Results: Results TablePC25HR Singapore: Accounting
P2RR_SRTPayroll Results: Results TablePC25HR Singapore: Accounting
P2RR_SVPayresult: Soc. Provident Funds/SGPC25HR Singapore: Accounting
P2RR_SVPayresult: Soc. Provident Funds/SGPC25HR Singapore: Accounting
P2RR_SVPayresult: Soc. Provident Funds/SGPC25HR Singapore: Accounting
P2RR_SVPayresult: Soc. Provident Funds/SGPC25HR Singapore: Accounting
T5R1MHR-SG: MembershipsPC25HR Singapore: Accounting
T5R3AHR-SG: AWS Union Subscription RatesPC25HR Singapore: Accounting
T5R8A_CAPCapping for IR8A BIK wagetypesPC25HR Singapore: Accounting
PA0494HR-PS-SG: Employee Suggestion Scheme - Evaluation ResultsP25P1Public Sector Singapore
PA0495HR-PS-SG: Pensions SchemeP25P4HR-PS-SG: Public Sector Singapore (Pensions Scheme)
PA0743HR master record infotype 0743 (Discipline)P25P2HR-Public Sector - Singapore - Add-on functionality
PA0752HR Master Record: Infotype 0752P25P2HR-Public Sector - Singapore - Add-on functionality
PA0752HR Master Record: Infotype 0752P25P2HR-Public Sector - Singapore - Add-on functionality
T5PBSR2BSI contr. table for Govt Pensionable Employees.P25P1Public Sector Singapore
T5PBSR2CPR contr. table for govt. pensionable employees.P25P1Public Sector Singapore
T5PBSR2DSI contr. table for Govt Non-pensionable EmployeesP25P1Public Sector Singapore
T5PBSR2EPR contr. table for Govt. non-pensionable employees.P25P1Public Sector Singapore
T7SIA5History of repaymentsPC62HR Slovenia
T7SIA6Bank transfer - interface tablePC62HR Slovenia
T7SIA9PC62HR Slovenia
PA0256Infotype 0256 - income from previous employersPB31Master data HR: Slovak Republic
PA0257Infotype 0257 - Annual tax calculation SKPB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
PA3350Personnel master record Infotype 3350PB31Master data HR: Slovak Republic
T7SKA1Bases for external paymentsPC31Payroll objects HR SK
T7SKA3Result values ATC for calculation programPC31Payroll objects HR SK
T7SKA4Auxiliary table HRSKPC31Payroll objects HR SK
T7SKAMTSTax Overview - outflows and returnsPC31Payroll objects HR SK
T7SKARZDAnnual tax clearingPC31Payroll objects HR SK
T7SKEC0011Log on table for EURO conversion - IT 0011PC31Payroll objects HR SK
T7SKELDZPeriod for pension provision reg.cert. (ELDZ)PC31Payroll objects HR SK
T7SKVDPAuxiliary table for HSKLVDP0PC31Payroll objects HR SK
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
PA0364Infotype Tax THPB26HR Master Data: Thailand
T7THTETermination Tax Rates THPB26HR Master Data: Thailand
T7THTRTax Rates THPB26HR Master Data: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
P2TH_TAXPayroll Structure for TAX - THPC26HR Payroll: Thailand
PA0772Personnel master data: Infotype 0772PB47HR-Payroll Turkey
PA0773Personnel master data: Infotype 0773PB47HR-Payroll Turkey
PA0776Personnel master data: Infotype 0776PB47HR-Payroll Turkey
PA0778Personnel master data: Infotype 0778PC47HR Payroll: Turkey
T7TRK01Allowance factors - notice periodsPB47HR-Payroll Turkey
T7TRK02Wage types for seniority paymentPB47HR-Payroll Turkey
T7TRK03Wage and salary increase for seniorityPB47HR-Payroll Turkey
T7TRS02Legal procents tablePB47HR-Payroll Turkey
T7TRS10Service Duration Additional SSK BasePB47HR-Payroll Turkey
T7TRS13Minimum Wage Incentive TablePB47HR-Payroll Turkey
T7TRT01Tax ClassesPB47HR-Payroll Turkey
T7TRT02Tax DeductionsPB47HR-Payroll Turkey
T7TRT03Disability ParametersPB47HR-Payroll Turkey
T7TRT05Annual Tax Compensation.PB47HR-Payroll Turkey
T7TRT08Personal Expenses Allowance (VAT Return) Amount and ProcentsPB47HR-Payroll Turkey
PA0357Saving Plan (TW)PB42HR Master Data: Taiwan
PA0357Saving Plan (TW)PB42HR Master Data: Taiwan
PA0358Employee Welfare Fund (TW)PB42HR Master Data: Taiwan
PA0818HR Master Record: Infotype 0818PB42HR Master Data: Taiwan
PA3223HR Master Record: Infotype 3223 (Deduction TW)PB42HR Master Data: Taiwan
PA3223HR Master Record: Infotype 3223 (Deduction TW)PB42HR Master Data: Taiwan
PA3223HR Master Record: Infotype 3223 (Deduction TW)PB42HR Master Data: Taiwan
PA3223HR Master Record: Infotype 3223 (Deduction TW)PB42HR Master Data: Taiwan
PA3223HR Master Record: Infotype 3223 (Deduction TW)PB42HR Master Data: Taiwan
T7TW0CMinimal Living Expense TaiwanPB42HR Master Data: Taiwan
T7TW1BInsurance Amount CategoryPB42HR Master Data: Taiwan
T7TW1DNHI Exempt Reason and amountPB42HR Master Data: Taiwan
T7TW2EWage type dependent tax rate (Taiwan)PB42HR Master Data: Taiwan
T7TW3AEmployment Stabilization FundPB42HR Master Data: Taiwan
T7TW3AEmployment Stabilization FundPB42HR Master Data: Taiwan
T7TW7ASNHI report history data recordPB42HR Master Data: Taiwan
P2TN_ESFPayroll Structure ESF TaiwanPC42Payroll: Taiwan
P2TN_ESFPayroll Structure ESF TaiwanPC42Payroll: Taiwan
P2TN_EWFPayroll Structure EWF TaiwanPC42Payroll: Taiwan
P2TN_NHIPayroll Structure NHI TaiwanPC42Payroll: Taiwan
P2TN_NHIFPayroll Structure NHIF TaiwanPC42Payroll: Taiwan
P2TN_NPTABPayroll Structure New Pension TaiwanPC42Payroll: Taiwan
P2TN_SAVPPayroll Structure Saving Plan TaiwanPC42Payroll: Taiwan
P2TN_SAVPPayroll Structure Saving Plan TaiwanPC42Payroll: Taiwan
P2TN_SIPayroll Structure Labor Insurance TaiwanPC42Payroll: Taiwan
P2TN_TWDCPayroll Structure TWDC TaiwanPC42Payroll: Taiwan
P2TN_TWOTPayroll Results: Results TablePC42Payroll: Taiwan
P2TN_TWOTPayroll Results: Results TablePC42Payroll: Taiwan
P2UA_FUPtable FUP - future periodsPC36HR Ukraine Payroll
P2UA_FUPtable FUP - future periodsPC36HR Ukraine Payroll
P2UA_UAAVHR-PAY: Cumulations for calculation of averagesPC36HR Ukraine Payroll
P2UA_UAAVHR-PAY: Cumulations for calculation of averagesPC36HR Ukraine Payroll
P2UA_UAINDUkrainian Salary Indexation by Customer Price IndexPC36HR Ukraine Payroll
P2UA_UARESUkrainian ReservesPC36HR Ukraine Payroll
P2UA_UARFStructure for Ukrainian social insurance(PF) calculationPC36HR Ukraine Payroll
P2UA_UARFStructure for Ukrainian social insurance(PF) calculationPC36HR Ukraine Payroll
P2UA_UARTPayroll Results: Results TablePC36HR Ukraine Payroll
P2UA_UARTPayroll Results: Results TablePC36HR Ukraine Payroll
P2UA_UATIStructure for Ukrainian social insurance(PF) calculationPC36HR Ukraine Payroll
P2UA_UATIStructure for Ukrainian social insurance(PF) calculationPC36HR Ukraine Payroll
P2UA_UATRStructure for Ukrainian social insurance(PF) calculationPC36HR Ukraine Payroll
P2UA_UATRStructure for Ukrainian social insurance(PF) calculationPC36HR Ukraine Payroll
P2UA_UATSStructure for Ukrainian social insurance(PF) calculationPC36HR Ukraine Payroll
P2UA_UATSStructure for Ukrainian social insurance(PF) calculationPC36HR Ukraine Payroll
P2UN_EGRTNPO: EG Internal summary structurePCUNPayroll Non Profit Organizations
P2UN_EGRTNPO: EG Internal summary structurePCUNPayroll Non Profit Organizations
P2UN_EGRTNPO: EG Internal summary structurePCUNPayroll Non Profit Organizations
P2UN_EGRTNPO: EG Internal summary structurePCUNPayroll Non Profit Organizations
P2UN_HTPayroll Results: Results TablePCUNPayroll Non Profit Organizations
P2UN_HTPayroll Results: Results TablePCUNPayroll Non Profit Organizations
P2UN_NTPayroll Results: Results TablePCUNPayroll Non Profit Organizations
P2UN_NTPayroll Results: Results TablePCUNPayroll Non Profit Organizations
P2UN_PKPension Fund, Payroll United NationsPCUNPayroll Non Profit Organizations
P2UN_QDDCONAustralia Public Sector: PayrollPCUNPayroll Non Profit Organizations
P2UN_QHDAHR-UN: Payroll structure for Higher Duty AllowancePCUNPayroll Non Profit Organizations
P2UN_QSPRHR-UN: Payroll structure for SuperannuationPCUNPayroll Non Profit Organizations
P2UN_RSUN Rental Subsidy internal structurePCUNPayroll Non Profit Organizations
P2UN_RSUN Rental Subsidy internal structurePCUNPayroll Non Profit Organizations
P2UN_RSUN Rental Subsidy internal structurePCUNPayroll Non Profit Organizations
PA0959HR Master Record: Infotype 0959PBUNMaster Data Non Profit Organizations
PA0959HR Master Record: Infotype 0959PBUNMaster Data Non Profit Organizations
PA0959HR Master Record: Infotype 0959PBUNMaster Data Non Profit Organizations
PA0962HR Master Record: Infotype 0962PBUNMaster Data Non Profit Organizations
PA0962HR Master Record: Infotype 0962PBUNMaster Data Non Profit Organizations
PA0962HR Master Record: Infotype 0962PBUNMaster Data Non Profit Organizations
PA0965HR Master Record: Infotype 0965PBUNMaster Data Non Profit Organizations
PA0965HR Master Record: Infotype 0965PBUNMaster Data Non Profit Organizations
PA0965HR Master Record: Infotype 0965PBUNMaster Data Non Profit Organizations
T7UNPAD_DDSADuty Station DSA Rates (Daily Subsistence Allowance)PBUNMaster Data Non Profit Organizations
T7UNPAD_DMSADuty Station MSA Rates (Mission Subsistence Allowance)PBUNMaster Data Non Profit Organizations
T7UNPAD_DSDADuty Station Dependency AllowancePBUNMaster Data Non Profit Organizations
T7UNPAD_EG05NPO: EG Settings for CountryPBUNMaster Data Non Profit Organizations
T7UNPAD_EGAMTNPO: EG EntitlementsPBUNMaster Data Non Profit Organizations
T7UNPAD_EGAMTNPO: EG EntitlementsPBUNMaster Data Non Profit Organizations
T7UNPAD_EGCTRNPO: EG Entitlement countriesPBUNMaster Data Non Profit Organizations
T7UNPAD_EGEXPMGTNPO: Expense Management TablePBUNMaster Data Non Profit Organizations
T7UNPAD_EGEXPMGTNPO: Expense Management TablePBUNMaster Data Non Profit Organizations
T7UNPAD_EGGSSNPO: EG Global Sliding ScalePBUNMaster Data Non Profit Organizations
T7UNPAD_EGPSHNPO: Education Grant Cost Flat ratesPBUNMaster Data Non Profit Organizations
T7UNPAD_EG_GSSMaintain Reimbursement Percentage for EG Brackets as per GSSPBUNMaster Data Non Profit Organizations
T7UNPAD_HSFAHardship flat amountsPBUNMaster Data Non Profit Organizations
T7UNPAD_MBFAMobility Flat amountsPBUNMaster Data Non Profit Organizations
T7UNPAD_NRFARemoval/Non Removal Flat amountsPBUNMaster Data Non Profit Organizations
T7UNPAD_RSACRRental Subsidy Average Commercial Rent AmountsPBUNMaster Data Non Profit Organizations
T7UNPAD_RSDARental Subsidy Entitlements (Amount)PBUNMaster Data Non Profit Organizations
T7UNPAD_RSMARental Subsidy Maximum AmountPBUN